KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_04255Help
Entry
O3O_04255         CDS       T02256                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:eso00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:eso00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4392153..4393640)
Genome map
AA seq 495 aa AA seqDB search
MADRNLRDLLAPWVPDAPSRALREMTLDSRVAAAGDLFVAVVGHQADGRRYIPQAIAQGV
AAIIAEAKDEATDGEIREMHGVPVIYLSQLNERLSALAGRFYHEPSDNLRLVGVTGTNGK
TTTTQLLAQWSQLLGETSAVMGTVGNGLLGKVIPTENTTGSAVDVQHELAGLVEQGATFC
AMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDMEHYEAAKWLLYSEHHCGQAIIN
ADDEVGRRWLAKLPDAVAVSMEDHINPNCHGRWLKAIDVNYHDSGATIRFSSSWGDGEIE
SHLMGAFNVSNLLLALATLLALGYPLADLLKTAARLQPVCGRMEVFTAPGKPTVVVDYAH
TPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLMGAIAEEFADVAVVTDDNPRTEE
PRAIINDILAGMLDAGHAKVMEGRAEAVTCAVMQAKENDVVLVAGKGHEDYQIVGNQRLD
YSDRVTVARLLGVIA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatcgtaatttgcgcgaccttcttgctccgtgggtgccagacgcaccttcgcga
gcactgcgagagatgacactcgacagccgtgtggctgcggcgggcgatctctttgtagct
gtagtaggtcatcaggcggacgggcgtcgatatatcccgcaggcgatagcgcaaggtgtg
gctgccattattgcagaggcgaaagatgaggcgaccgacggtgaaatccgtgaaatgcac
ggcgtaccggtcatctatctcagccagctcaacgagcgtttatctgcactggcgggccgc
ttttaccatgaaccctctgacaatttacgtctcgtaggcgtaacgggcaccaacggcaaa
accacgactacccagctgctggcgcagtggagccaactgcttggcgaaaccagcgcggta
atgggcaccgttggtaacggtctgcttgggaaagtgatcccgacagaaaatactaccggt
tccgcagtcgatgttcagcatgagctggcggggctggtggagcagggcgcgacgttttgc
gcaatggaagtttcctcccacgggctggtacagcaccgtgtggcggcattgaaatttgcg
gcgtcggtctttaccaacttaagccgcgatcaccttgattatcatggtgatatggaacac
tacgaagctgcgaaatggctgctttattctgaacatcattgcggtcaggcgattattaac
gccgacgatgaagtgggccgccgctggctggcaaaactgccggacgcggttgcggtatca
atggaagatcatatcaatccgaactgtcacggacgctggttaaaagcgatcgacgtgaac
tatcacgacagcggtgcgacgattcgctttagctcaagttggggcgatggcgaaattgaa
agccatctgatgggcgcttttaacgtcagcaacctgctgctcgcgctggcgacactgctg
gcactcggctatccactggctgatctgctgaaaaccgccgcgcgtctgcaaccggtttgc
ggacgtatggaagtgttcactgcgccaggcaaaccgacggtggtggtggattacgcgcat
acgccggatgcactggaaaaagccttacaggcggcgcgcctgcactgtgcgggcaagctg
tggtgcgtctttggctgtggtggcgatcgcgataaaggtaagcgtccactgatgggcgca
attgccgaagagtttgctgacgtggcggtggtgacggacgataacccgcgtaccgaagaa
ccgcgtgccatcatcaacgatattctggcgggaatgttagatgccggacatgccaaagtg
atggaaggccgtgctgaagcggtgacttgcgccgttatgcaggctaaagagaatgatgtg
gtactggtcgcgggcaaaggccatgaagattaccagattgttggcaatcagcgtctggac
tactccgatcgcgtcacggtggcgcgtctgctgggggtgattgcatga

DBGET integrated database retrieval system