KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_07025Help
Entry
O3O_07025         CDS       T02256                                 

Gene name
asnB
Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:eso00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3775863..3777527
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVFDIKTDAVELRKKALELSRLMRHRGPDWSGIYASDNAILAHERLSIVDVNAGA
QPLYNQQKTHVLAVNGEIYNHQALRAEYGDRYQFQTGSDCEVILALYQEKGPEFLDDLQG
MFAFALYDSEKDAYLIGRDHLGIIPLYMGYDEHGQLYVASEMKALVPVCRTIKEFPAGSY
LWSQDGEIRSYYHRDWFDFDAVKDNVTDKNELRQALEDSVKSHLMSDVPYGVLLSGGLDS
SIISAITKKYAARRVEDQERSEAWWPQLHSFAVGLPGSPDLKAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLY
FHKAPNAKELHEETVRKLLALHMYDCARANKAMSAWGVEARVPFLDKKFLDVAMRINPQD
KMCGNGKMEKHILRECFESYLPASVAWRQKEQFSDGVGYSWIDTLKEVAAQQVSDQQLET
ARFRFPYNTPTSKEAYLYREIFEELFPLPSAAECVPGGPSVACSSAKAIEWDEAFKKMDD
PSGRAVGVHQSAYK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcaatttttggcgtattcgatatcaaaacagacgcagttgagctgcgtaagaaa
gcactcgagctgtcacgcctgatgcgtcatcgtggcccggactggtccggtatttatgcc
agcgataacgccattctcgcccacgaacgtctgtcaattgttgacgttaacgcgggggcg
caacctctctacaaccaacaaaaaactcatgtgctggcggtaaacggtgaaatctacaac
caccaggcactgcgcgccgaatatggcgatcgttatcagttccagaccggatctgactgc
gaagtgatcctcgcgctgtatcaggaaaaagggccggaatttctcgacgacttgcagggc
atgtttgcctttgccctgtacgacagcgaaaaagatgcatatctgattggtcgcgaccat
ctggggatcatcccactgtatatgggctatgacgagcacggtcagctgtatgtggcctca
gaaatgaaagccctggtgccagtttgccgcacgattaaagagttcccggcggggagctat
ttgtggagtcaggacggcgaaatccgttcttattatcatcgcgactggttcgactttgat
gcagtgaaagataacgtgaccgacaaaaacgagctgcgtcaggcactggaagattccgtt
aaaagccatctgatgtctgacgttccttacggtgtgctgctctcgggtggtctggattcc
tcaattatttccgcgatcaccaagaaatacgccgcccgtcgcgtggaagatcaggaacgc
tctgaagcctggtggccgcaattacactcctttgctgtaggtctgccgggttcaccggat
ctgaaagcagcccaggaagtggcaaaccatctgggcacggtgcatcacgaaattcacttc
actgtacaggaaggtctggatgccatccgcgacgtgatttaccacatcgaaacctatgat
gtgacaactattcgcgcttcaacaccgatgtatttaatgtcgcgtaagatcaaggcaatg
ggcattaaaatggtgctgtccggtgaaggttctgatgaagtgtttggcggttatctttac
ttccacaaagcaccgaatgccaaagaactgcatgaagagacggtgcgtaaactgctggcc
ctgcatatgtatgactgcgcgcgcgccaacaaagcgatgtcagcctggggcgtggaagca
cgcgttccgttcctcgacaaaaaattccttgatgtggcgatgcgcattaacccgcaggat
aaaatgtgcggtaacggcaaaatggaaaaacacatcctgcgtgaatgttttgagtcatac
ctgcccgcaagcgtggcctggcggcagaaagagcagttctccgatggcgtcggttacagt
tggatcgacaccctgaaagaagtggcggcgcagcaggtttctgatcagcaactggaaact
gcccgcttccgcttcccgtacaacacgccaacctcaaaagaagcgtatctgtaccgggag
atctttgaagaactgttcccgcttccgagcgccgctgagtgcgtgcctggcggtccttcc
gtcgcgtgttcttccgctaaagcgattgagtgggatgaggcgttcaagaaaatggacgat
ccgtctggtcgtgcggttggcgttcaccagtcggcgtataagtaa

DBGET integrated database retrieval system