KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_07630Help
Entry
O3O_07630         CDS       T02256                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3657329..3657826)
Genome map
AA seq 165 aa AA seqDB search
MPPSLRKAVAAAIGGGAIATASVLITGPSGNDGLEGVSYIPYKDIVGVWTVCHGHTGKDI
MLGKTYTEAECKALLNKDLATVARQINPYIEVDIPETTRGALYSFVYNVGAGNFRTSTLL
RKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREVCLWGQQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcctccatcattacgaaaagccgttgctgctgctattggtggcggagcaattgctaca
gcatcagtgttaatcactggcccaagtggtaacgatggtctggaaggtgtcagctacata
ccatacaaagatattgttggtgtatggactgtatgtcacgggcatacaggaaaagacatc
atgctcggtaaaacgtataccgaagcagagtgcaaagccctcctgaataaagaccttgcc
actgtcgccaggcaaattaacccgtatatcgaagtcgatataccggaaacaacgcgcggc
gctctttactcattcgtttacaacgtgggtgctggcaatttcagaacatcgacgcttctt
cgcaaaataaaccagggcgatatcaaaggcgcatgtgatcagctacgtcgctggacatat
gctggcggtaagcaatggaaagggctgatgactcgccgtgagattgagcgtgaagtctgt
ttgtgggggcagcaatga

DBGET integrated database retrieval system