KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_11385Help
Entry
O3O_11385         CDS       T02256                                 

Definition
phage-related lysozyme (muraminidase)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Brite
Enzymes [BR:eso01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     O3O_11385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2919243..2919776)
Genome map
AA seq 177 aa AA seqDB search
MNTKIKYGLSAAVLALIAAGAPAPDILDQFLDEKEGNHTTAYRDGAGIWTICRGAILVDG
KPVVPGMKLSKEKCDQVNAIERDKALAWVEKNIRVPLTEPQKAGIASFCPYNIGPGKCFP
STFYRRINAGDRRGACEAIRWWIKDGGRDCRIRSNNCYGQVSRRDQESALACWGIDR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccaaaatcaaatacggcctgtcggctgccgttctggcgctgattgccgctggt
gcgcctgcgcctgacattctcgaccagtttctggatgaaaaggaaggtaaccacaccacg
gcataccgtgatggcgcgggtatctggaccatctgtcgcggtgccattctggtggatggt
aaacctgtcgtcccgggcatgaagttgtcgaaggagaaatgcgaccaggttaacgccatc
gaacgtgataaggcgctggcatgggtggagaaaaacatcagagtgccattgaccgaaccc
cagaaagcggggatcgcgtcattctgtccgtacaacattggtcccggtaagtgtttcccg
tcgacgttttacagacgaattaatgctggtgatcgcaggggagcatgtgaggcgattcgc
tggtggattaaggacggtggcagagactgccgtattcgctcaaataactgttacggtcag
gtatcccgtcgtgaccaggagagcgcgctggcgtgctggggaatcgacagataa

  All links  
No link information was found.   
DBGET integrated database retrieval system