KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_12825Help
Entry
O3O_12825         CDS       T02256                                 

Gene name
celA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:eso00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2610035..2611474
Genome map
AA seq 479 aa AA seqDB search
MSGFKKGFLWGGAVAAHQLEGGWNEGGKGISIADVMTAGAHGVPREVTEGVIDGLNYPNH
EAIDFYHRYKTDIQLFAEMGFKCFRTSIAWTRIFPQGDEQEPNEEGLQFYDDLFDECLKQ
GMEPVVTLSHFEMPYHLVTKYGGWRNRKLIDFFIRFASTVFTRYKEKVKYWMTFNEINNQ
VNFSESLCPFTNSGILYSPEEDINEREQIMYQAVHYELVASALAVQTGKSINPEFNIGCM
IAMCPIYPLTCAPNDMMMATKAMHRRYWFTDVHARGYYPQHMLNYFARKGFNLDITPEDN
AILASGCVDFIGFSYYMSFTTQFSPDNPQLDYVEPRDLVSNPYIDTSEWGWQIDPAGLRY
SLNWFWDHFQLPLFIVENGFGAVDQRQADGTVNDHYRIDYFASHIREMKKAVVEDGVDLI
GYTPWGCIDLVSAGTGEMKKRYGMIYVDKDNEGKGTLERIRKASFYWYRDLIANNGENI
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggatttaaaaaaggttttttatggggcggtgcggtagccgcgcatcagttggaa
ggtggctggaatgaaggaggaaaaggcatcagcatcgctgatgtgatgactgctggcgct
cacggggtgccgcgtgaagtgacagaaggcgttatcgacgggcttaattatcccaatcat
gaagcaattgatttttatcatcgctataaaacagatattcagttatttgccgagatggga
ttcaaatgctttcgaacttccattgcctggacacgaatctttccgcaaggtgacgaacag
gagccgaatgaagagggtttacaattttatgatgatctgttcgatgaatgccttaagcag
ggaatggaacctgtggtgacgctttcacattttgagatgccttatcatctggtgacaaaa
tatggtggctggcgaaaccgtaaactgatcgacttttttatccgcttcgcatcaacggtc
ttcacgcgctataaagaaaaagtaaagtactggatgacgtttaacgaaatcaataatcag
gtgaatttcagcgaaagcctgtgtccatttactaattccggtatcttgtattcgccagag
gaagatatcaatgagcgcgaacaaataatgtaccaggcggtacattacgagttagttgcc
agtgccctggcggtacagactggaaaatcgatcaatcctgaatttaacattggctgtatg
atcgccatgtgtcccatctatcctctgacgtgtgcacccaacgatatgatgatggccacg
aaagcaatgcatcgtcgttactggtttactgatgttcatgctcgtggatattatccgcaa
catatgctgaattactttgccaggaaaggattcaacctcgatatcacaccagaagataac
gcgattcttgccagtggttgtgtcgactttatcggctttagctactacatgtcttttacg
acacaattttcgcccgataacccgcaactggattatgttgaaccacgagatttggtcagc
aacccttatatcgatacatccgaatggggatggcaaattgatccggcagggctacgttat
tcactcaactggttctgggatcatttccagttgccgctgtttattgtcgaaaatggattt
ggtgcggttgaccagagacaagctgacggcacggtgaacgatcactatcgcattgattac
tttgcttcccatattcgggaaatgaaaaaagccgtagttgaagatggtgttgacttaatt
ggctacaccccgtggggctgcattgacctggtttctgccggaacaggggaaatgaaaaag
cgctacggaatgatttatgtcgataaagacaacgaagggaagggaacgctggaacggata
cgtaaagcgtcgttttactggtatcgggatctcatcgccaacaatggcgaaaatatttga

DBGET integrated database retrieval system