KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_13955Help
Entry
O3O_13955         CDS       T02256                                 

Gene name
btuE
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:eso00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    O3O_13955 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    O3O_13955 (btuE)
Enzymes [BR:eso01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     O3O_13955 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2392209..2392760
Genome map
AA seq 183 aa AA seqDB search
MQDSILTTVVKDIDGEVTTLEKYAGNVLLIVNVASKCGLTPQYEQLENIQKAWADRGFVV
LGFPCNQFLEQEPGSDEEIKTYCTTTWGVTFPMFSKIEVNGEGRHPLYQKLIAAAPTAVA
PEESGFYARMVSKGRAPLYPDDILWNFEKFLVGRDGKVIQRFSPDMTPEDPIVMESIKLA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaagattccattctgacgaccgtagtgaaagatatcgacggtgaagtgaccacgctg
gagaagtacgccggtaatgtgctgttgattgtcaatgtcgcctcaaagtgtggcttaacg
ccgcaatatgagcagttggagaatattcagaaagcctgggccgatcgaggttttgtggtg
ctgggattcccgtgcaaccagtttctggaacaagaaccgggcagcgatgaagagattaaa
acttactgtaccaccacatggggggtgacgttcccgatgttcagtaagattgaagttaat
ggcgaaggacgccatccgctgtatcaaaaattgattgccgcagcgccgaccgcagtcgcg
ccggaagagagcggattctatgcccgtatggtcagcaaaggccgtgcaccgctgtacccg
gatgatattttatggaattttgaaaaattcctggttggcagggacggaaaagtcatccag
cgtttttccccggatatgacgccggaagatcccattgtgatggaaagcattaaactggcg
ttggcaaaataa

DBGET integrated database retrieval system