KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_15440Help
Entry
O3O_15440         CDS       T02256                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:eso02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:eso02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2127324..2128373
Genome map
AA seq 349 aa AA seqDB search
MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKFNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAIDFVTKPQLGIREGMLAYS
EMIAEKVRTAAKASLAAHKPLSAPTTLKAGPLLSSEKLIAIGASTGGTEAIRHVLQPLPL
SSPALLITQHMPPGFTRSFADRLNKLCQIGVKEAEDGERVLPGHAYIAPGDRHMELSRSG
ANYQIKIHDGPAVNRHRPSVDVLFHSVAKQAGRNAVGVILTGMGNDGAAGMLAMRQAGAW
TLAQNEASCVVFGMPREAINMGGVCEVVDLSQVSQQMLAKISAGQAIRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaatcagggtgttatctgtcgatgattcggcactgatgcgccagatcatgaca
gaaatcatcaacagccatagcgacatggaaatggtggcgaccgcgcctgatccgctggtc
gcgcgtgacttgattaagaaattcaatcccgatgtgctgacgctggatgttgaaatgccg
cggatggacggactggatttcctcgaaaaattaatgcgtttgcgtccaatgcccgtagtg
atggtttcttccctgactggcaaagggtcagaagtcacgctgcgcgcgctggagctgggg
gcgatagattttgtcaccaaaccgcaactgggtattcgcgaaggaatgctggcgtatagc
gaaatgattgctgaaaaggtgcgtacagcagcaaaggcgagccttgcagcacataagcca
ttgtcagcaccgacaacgctgaaggcgggtccgttgttgagttctgaaaaactgattgcg
attggtgcttcaacgggtggaactgaggcaattcgtcacgtactgcaaccgttgccgctt
tccagcccggcattgttaattacccagcatatgccgcccggtttcacccgctcttttgcc
gacagacttaataagctttgccagatcggggttaaagaagccgaagacggagaacgtgtc
ttgccggggcatgcctatattgcgccgggcgatcggcatatggagctgtcgcgtagtggc
gcaaattaccaaatcaaaattcacgatggcccggcggttaaccgtcatcggccttcggta
gatgtgttgttccattctgtcgccaaacaggcggggcgtaatgcggttggggtgatcctg
accggtatgggcaacgacggcgcggcgggaatgttggcgatgcgtcaggcgggggcatgg
acccttgcgcaaaacgaagcaagttgcgtggtgttcggcatgccgcgcgaggccatcaat
atgggtggtgtctgcgaagtggtcgatcttagccaggtaagccagcaaatgttggcaaaa
attagtgccggacaggcgatacgtatttaa

DBGET integrated database retrieval system