KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_16400Help
Entry
O3O_16400         CDS       T02256                                 

Definition
GalU regulator GalF (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eso00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    O3O_16400
   00052 Galactose metabolism
    O3O_16400
   00500 Starch and sucrose metabolism
    O3O_16400
   00520 Amino sugar and nucleotide sugar metabolism
    O3O_16400
Enzymes [BR:eso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     O3O_16400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1938006..1938899
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLSE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttataccggtagcgggtcttgggatgcatatgttgcctgcc
actaaggcgatacccaaagagatgctaccgatcgtcgacaagccaatgattcagtacatt
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcatgcgtccaag
aacgcggtcgaaaaccactttgacacctcttatgaattagaatctctccttgaacagcgt
gtgaagcgtcagctgctggcggaagtgcagtcgatctgcccgccgggcgtaaccattatg
aacgtgcgtcagggcgaacctttaggtttgggccactccattttatgtgcacgacccgcc
attggtgacaacccatttgtcgtggtgctgccagacgttgtgatcgacgacgccagcgcc
gacccgctgcgctacaaccttgcagccatgattgcgcgcttcaacgaaacgggacgcagc
caggtgctggcaaaacgtatgccgggtgacctctctgaatactccgtcatccagaccaaa
gagccgctggatcgtgaaggcaaagtcagccgcattgttgaatttatcgaaaaacctgat
cagccgcagacgctggactcagacatcatggccgttggtcgctatgtgctttctgccgat
atttggccggaacttgaacgcacgcagcctggtgcgtggggacgtattcagctgactgat
gctattgccgaactggcgaaaaaacaatctgttgatgcaatgctgatgacaggtgatagc
tacgactgcggtaaaaaaatgggttatatgcaggcgtttgtgaagtatggactacgcaac
ctgaaagaaggggcgaagttccgtaaaggcattgagaagctgttaagcgaataa

DBGET integrated database retrieval system