KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_16955Help
Entry
O3O_16955         CDS       T02256                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:eso00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1807033..1807701
Genome map
AA seq 222 aa AA seqDB search
MPSLSKEAALVHEALVARGLETPLRPPVHEMDNETRKSLIAGHMTEIMQLLNLDLADDSL
METPHRIAKMYVDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDG
KATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERLTQQILIALQTLLGTNNVAVSIDAVH
YCVKARGIRDATSATTTTSLGGLFKSSQNTRHEFLRAVRHHN
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgccatcactcagtaaagaagcggccctggttcatgaagcgttagttgcgcgaggactg
gaaacaccgctgcgcccgcccgtgcatgaaatggataacgaaacgcgcaaaagccttatt
gctggtcatatgaccgaaatcatgcagctgctgaatctcgacctggctgatgacagtttg
atggaaacgccgcatcgcatcgctaaaatgtatgtcgatgaaattttctccggtctggat
tacgccaacttcccgaaaatcaccctcattgaaaacaaaatgaaggtcgatgaaatggtc
accgtgcgcgatatcactctgaccagtacctgtgaacaccattttgttaccatcgatggc
aaagcgacggtggcttatatcccgaaagattcggtgatcggtctgtcaaaaattaaccgt
atcgtgcagttctttgcccagcgtccgcaggtgcaggaacgtctgacgcagcaaattctt
attgcgctacaaacgctgctgggcaccaataacgtggctgtctcgatcgacgcggtgcat
tactgcgtgaaggcgcgtggcatccgcgatgcaaccagtgccacaacaacgacctctctt
ggtggattgttcaaatccagtcagaatacgcgccacgagtttctgcgcgctgtgcgtcat
cacaactga

DBGET integrated database retrieval system