KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_20885Help
Entry
O3O_20885         CDS       T02256                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:eso00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    O3O_20885
Enzymes [BR:eso01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     O3O_20885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
964944..965864
Genome map
AA seq 306 aa AA seqDB search
MSTLGHQYDNSLVSNAFGFLRLPMNFQPYDSDADWVITGVPFDMATSGRAGGRHGPAAIR
QVSTNLAWEHNRFPWNFDMRERLNVVDCGDLVYAFGDAREMSEKLQAHAEKLLAAGKRML
SFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYANGCEFDHGTMFYTAPKEGLIDPNH
SVQIGIRTEFDIDNGFTVLDACQVNDRSVDDVIAQVKQIVGDMPVYLTFDIDCLDPAFAP
GTGTPVIGGLTSDRAIKLVRGLKDLNIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQ
AAKKGE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccttaggtcatcaatacgataactcactggtttccaacgcctttggtttttta
cgcctgccgatgaacttccagccgtatgacagcgatgctgactgggtgattactggtgtg
ccgttcgacatggccacctctggccgtgccggtggtcgccacggtccggcagcgatccgt
caggtttcgacgaatctggcctgggaacacaatcgcttcccgtggaatttcgacatgcgt
gagcgtctgaacgtcgtggactgcggtgatctggtatatgctttcggcgatgcccgtgag
atgagcgagaagctgcaggcgcacgccgagaagctgctggctgccggtaagcgtatgctc
tccttcggtggtgaccactttgttacgctgccgctgctgcgtgctcatgcgaagcatttc
ggtaaaatggcgctggtacactttgacgcccacaccgatacctatgcgaacggttgtgaa
tttgaccacggcaccatgttctataccgcgccgaaagaaggtctgatcgacccgaatcat
tccgtgcagattggtattcgtaccgagtttgatatagacaacggctttaccgtgctggac
gcctgccaggtgaacgatcgcagcgtggatgacgttatcgcccaggtgaaacagattgtg
ggtgatatgccggtttacctgacctttgatatcgactgcctggatcctgcttttgcacca
ggcaccggtacgccagtgattggcggcctgacctccgatcgcgctattaaactggtacgc
ggcctgaaagatctcaacatcgttgggatggacgtagtggaagtggctccggcatatgat
cagtcggaaatcaccgctctggctgcggcgacgctggcgctggagatgctgtatattcag
gcggcgaaaaagggcgagtaa

DBGET integrated database retrieval system