KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_22650Help
Entry
O3O_22650         CDS       T02256                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eso00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    O3O_22650
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    O3O_22650
Enzymes [BR:eso01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     O3O_22650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
602741..604000
Genome map
AA seq 419 aa AA seqDB search
MDKFRVQGPTKLQGEVTISGAKNAALPILFAALLAEEPVEIQNVPKLKDVDTSMKLLSQL
GAKVERNGSVHIDARDVNVFCAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCTIGAR
PVDLHISGLEQLGATIKLEEGYVKASVDGRLKGAHIVMDKVSVGATVTIMCAATLAEGTT
IIENAAREPEIVDTANFLITLGAKISGQGTDRIVIEGVERLGGGVYRVLPDRIETGTFLV
AAAISRGKIICRNAQPDTLDAVLAKLRDAGADIEVGEDWISLDMHGKRPKAVNVRTAPHP
AFPTDMQAQFTLLNLVAEGTGFITETVFENRFMHVPELSRMGAHAEIESNTVICHGVEKL
SGAQVMATDLRASASLVLAGCIAEGTTVVDRIYHIDRGYERIEDKLRALGANIERVKGE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggataaatttcgtgttcaggggccaacgaagctccagggcgaagtcacaatttccggc
gctaaaaatgctgctctgcctatcctttttgccgctctactggcggaagaaccggtagag
atccagaacgtcccgaaactgaaagacgtcgatacatcaatgaagctgctaagccagctg
ggtgcgaaagtagaacgtaatggttctgtgcatattgatgcccgcgacgttaatgtattc
tgcgcaccttacgatctggttaaaaccatgcgtgcttctatctgggcactggggccgctg
gtagcgcgctttggtcaggggcaagtttcactgcctggcggttgtacgatcggtgcgcgt
ccggttgatctacacatttctggcctcgaacaattaggcgcgaccatcaaactggaagaa
ggttacgttaaagcttccgtcgatggtcgtctgaaaggcgcacatatcgtgatggataaa
gtcagcgttggcgcaacggtgaccatcatgtgtgctgcaaccctggcggaaggtaccacg
attattgaaaacgcagcgcgtgaaccggaaatcgtcgataccgcgaacttcctgattacg
ctgggtgcgaaaattagcggtcagggcaccgatcgtatcgtcatcgaaggtgtggaacgt
ttaggcggcggtgtctatcgcgtgctaccggatcgtatcgaaaccggtactttcctggtg
gcggcggcgatttctcgcggcaaaattatctgccgtaacgcgcagccagatactctcgac
gccgtgctggcgaaactgcgtgacgctggagcggacatcgaagtcggcgaagactggatt
agcctggatatgcatggcaaacgtccgaaggctgttaacgtacgtaccgcgccgcatccg
gcattcccgaccgatatgcaggcccagttcacgctgttgaacctggtggcagaagggacc
ggattcatcaccgaaacggtctttgaaaaccgctttatgcatgtgccggagcttagccgt
atgggcgcgcatgccgaaatcgaaagcaataccgttatttgtcacggtgttgaaaaactt
tctggcgcacaggttatggcaaccgatctgcgtgcatcagcaagcctggtgctggctggc
tgtattgcggaagggacgacggtggttgatcgtatttatcacatcgatcgtggctacgaa
cgcattgaagacaaactgcgcgctttaggtgcaaatattgagcgtgtgaaaggcgagtaa

DBGET integrated database retrieval system