KEGG   Escherichia coli O104 H4 2009EL-2071: O3O_25155Help
Entry
O3O_25155         CDS       T02256                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K18974  dihydropteroate synthase type 1 [EC:2.5.1.15]
Organism
eso  Escherichia coli O104:H4 2009EL-2071
Pathway
eso00790  Folate biosynthesis
eso01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eso00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    O3O_25155
Enzymes [BR:eso01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     O3O_25155
Antimicrobial resistance genes [BR:eso01504]
 Gene variants
  Sulfonamide resistance genes
   Dihydropteroate synthase
    O3O_25155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AFS88740
Position
78800..79579
Genome map
AA seq 259 aa AA seqDB search
MVTVFGILNLTEDSFFDESRRLDPAGAVTAAIEMLRVGSDVVDVGPAASHPDARPVSPAD
EIRRIAPLLDALSDQMHRVSIDSFQPETQRYALKRGVGYLNDIQGFPDPALYPDIAEADC
RLVVMHSAQRDGIATRTGHLRPEDALDEIVRFFEARVSALRRSGVAADRLILDPGMGFFL
SPAPETSLHVLSNLQKLKSALGLPLLVSVSRKSFLGATVGLPVKDLGPASLAAELHAIGN
GADYVRTHAPGDLRALLQS
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggtgacggtgttcggcattctgaatctcaccgaggactccttcttcgatgagagccgg
cggctagaccccgccggcgctgtcaccgcggcgatcgaaatgctgcgagtcggatcagac
gtcgtggatgtcggaccggccgccagccatccggacgcgaggcctgtatcgccggccgat
gagatcagacgtattgcgccgctcttagacgccctgtccgatcagatgcaccgtgtttca
atcgacagcttccaaccggaaacccagcgctatgcgctcaagcgcggcgtgggctacctg
aacgatatccaaggatttcctgaccctgcgctctatcccgatattgctgaggcggactgc
aggctggtggttatgcactcagcgcagcgggatggcatcgccacccgcaccggtcacctt
cgacccgaagacgcgctcgacgagattgtgcggttcttcgaggcgcgggtttccgccttg
cgacggagcggggtcgctgccgaccggctcatcctcgatccggggatgggatttttcttg
agccccgcaccggaaacatcgctgcacgtgctgtcgaaccttcaaaagctgaagtcggcg
ttggggcttccgctattggtctcggtgtcgcggaaatccttcttgggcgccaccgttggc
cttcctgtaaaggatctgggtccagcgagccttgcggcggaacttcacgcgatcggcaat
ggcgctgactacgtccgcacccacgcgcctggagatctgcgggcactgttgcaaagttag

DBGET integrated database retrieval system