KEGG   Eubacterium siraeum V10Sc8a: ES1_03470Help
Entry
ES1_03470         CDS       T02589                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
esr  Eubacterium siraeum V10Sc8a
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:esr01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:esr00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(371693..372478)
Genome map
AA seq 261 aa AA seqDB search
MDFSSVKRIVIKVGTSTLAHNTGNLNIRRVSKLIEVMSDLKNSGKDVIFVTSGAQGVGAA
KAGLHSKPKEMPKKQACAAIGQCELMHIYDREFANYNHTVAQVLLTRDVISNKTRKENVI
NTFNTLLDMGIVPIINANDTVSIQELDFDENDTLSAIVAALCSADLLIILTDVDGLYDKN
PKLPGAKLIPEVKQITSEMISSAKDKGSEFASGGMITKLEAATIAKEHGIPTVIINGQRP
EILYDLFENKAVCTVFTADED
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggatttttcaagtgtaaagagaattgttataaaggtaggcacaagcacgcttgcccat
aacacaggcaatcttaatataagacgtgtttcaaagctgatagaggtaatgtcggatctg
aaaaattccggcaaggacgtgatatttgttacatcgggcgcacagggcgtaggtgcggca
aaggcaggacttcactcgaagcctaaggagatgccgaaaaagcaggcttgcgccgctata
ggtcagtgcgagcttatgcacatttacgaccgtgaatttgcaaactacaatcacacggtc
gcacaggtgcttcttacccgtgacgttatcagcaacaagacaagaaaagagaacgttata
aacacgttcaatacgcttcttgatatgggcatagtgcctataatcaacgcaaatgatacc
gtttcgatacaggagcttgactttgacgagaacgatacgttatccgcaatagtagcggca
ctgtgcagtgccgacctgctgataatccttaccgatgttgacggcttatacgacaagaac
cctaagcttcccggcgcaaagctgattcctgaggtaaagcagataacaagcgagatgata
agttcggcaaaggacaagggcagtgagtttgcaagcggcggtatgataacaaagcttgag
gcggctactatcgcaaaggaacacggcataccgactgtaataataaacggtcagcgtccc
gaaatactttacgatttgtttgagaataaggctgtctgcacagtattcaccgcagatgag
gactga

DBGET integrated database retrieval system