KEGG   Eubacterium siraeum V10Sc8a: ES1_05550Help
Entry
ES1_05550         CDS       T02589                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
esr  Eubacterium siraeum V10Sc8a
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:esr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ES1_05550
  Lipid metabolism
   00561 Glycerolipid metabolism
    ES1_05550
   00600 Sphingolipid metabolism
    ES1_05550
Enzymes [BR:esr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     ES1_05550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
597695..598885
Genome map
AA seq 396 aa AA seqDB search
MEKLLGMTPPMGWNSWNTFTWEINEELIKQAADAFIENGLKDAGYEYVVIDDCWSEKQRN
EKGELVPDHWKFPNGIKPVADYVHSKGLKFGIYSCAGTHTCAGHPGSFEHEFQDAETFAE
WGVDYLKYDYCYKPVHIPGEILYKRMSTALRNCGRPIMFSACNWGNDDIYKWIRESGAHL
FRSTGDIQDNWESIKRLALSQMGNECYGGCFCHNDIDMLVVGMHGGSNNQYINGESDDQF
GNKEGKGLGGCTDTEYKTHFSLWAMMNSPLMMGCDIRHMTDRTKEILTNKEVIAINQDIE
CRGPYRISQWNNPENVFSLVKPLANGDYAIGMYNFSDVPAEMSLQFWDIGLSTAAGRGLE
MHDCWSHEDIGRFSERYVTTLQPHDCAVYTAKVVKL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagttactcggaatgacgccccctatgggctggaacagttggaacacgttcacc
tgggaaataaacgaagagcttataaagcaggcggctgacgcattcatcgaaaacggtctc
aaggacgcaggctatgaatatgttgttatagacgattgctggagcgaaaagcagagaaac
gaaaagggcgagcttgtgcctgatcattggaagttcccgaacggtatcaagcccgttgcg
gactacgttcactcaaagggtcttaagttcggcatctattcatgtgccggcacgcatacc
tgcgcaggtcaccccggcagcttcgagcatgaatttcaggacgcagaaacgttcgcagag
tggggcgttgactacctgaaatatgactattgctacaagcccgtgcatatacccggcgag
atactctacaagcgtatgtctaccgccctcagaaactgcggcagaccgataatgttctcc
gcttgcaactggggtaatgacgatatatacaagtggataagagagagcggcgctcatctt
ttccgctcgacaggcgatatacaggataactgggagtcgataaagcgccttgcgctgtcg
cagatgggcaacgagtgctacggcggctgcttctgtcacaatgatatagatatgctcgta
gtcggtatgcacggcggctcgaacaaccagtacataaacggcgagagcgacgatcagttc
ggcaataaggaaggcaagggtcttggcggctgtaccgatacagagtacaagacgcatttc
tcactgtgggcaatgatgaattcaccgcttatgatgggctgtgatatccgtcatatgacc
gacaggacaaaggagatacttaccaataaggaagttatcgcaataaatcaggacattgag
tgcagaggaccttaccgcataagccagtggaacaaccccgaaaatgtattctcacttgta
aagccgcttgcaaacggcgactacgctataggtatgtataacttcagcgatgttcctgcg
gaaatgtcgttacagttctgggatatagggctcagcactgcggcaggcagaggacttgaa
atgcacgattgctggtcgcacgaggatataggcagattctccgagagatatgtaactacc
ttacagccccacgattgtgctgtatatactgcaaaggtagtaaagctgtaa

DBGET integrated database retrieval system