KEGG   Eubacterium siraeum V10Sc8a: ES1_05860Help
Entry
ES1_05860         CDS       T02589                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
esr  Eubacterium siraeum V10Sc8a
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:esr00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:esr00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:esr00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(640546..642738)
Genome map
AA seq 730 aa AA seqDB search
MSIVFDENKRVFKLDTEKSSYAFHITDSRNLLHLYYGGYIPETDITHMLRIPNDEPFVPA
VHDAMGPHSFDCAPIEFPTSGVADFREPAMQVMDINGMSACECYYKDYRISNGKPKLKGL
PATYAADDEAQTLEVFCYDPHSGLDITLMYSVFPKFDVITRSVKVENNGLAAIDLRRIIS
MSLDLDRMDYDMITLHGTWARERHVQRFPIRFGKQSIDSNRGATSHAHNNFFALCDHTAT
EDFGEAYGFALVYSGSFLGMVEVGQYEKTRALLGINPYDFSWHLEPGEDFQAPEVIMTYS
GEGLGQMSRNFHDVMRNNLIRGKWKDMRRPILINNWEATYFNFDTDKLLDIAREAKKAGI
EMLVMDDGWFGHRNDDKSSLGDWFVNEDKIKGGLKHLVDEVNKIGLKFGIWFEPEMISPD
SKLYAEHQDWCIHIPGRHRTTVRSQLVLDFSRKEVRDYIYEQMKAILSSANIEYVKWDMN
RQLSEVGNEVFPPERQREIWHRYVLGVYEMQERLLTDFPDLLLENCAGGGSRFDAGMLYY
SPQIWTSDDTDAIERLKIQYGTSMCYPCSCFGAHVSDSPNHCVGRITPFETRGHVAMSGT
FGYELDVTRISDDDKYAIKEQIEEFNKYNPLVRTGDYYRIGNPFANDRFDAWQFVAKDKS
ETLLEYVQVLKEPSVFLHRVKLKGLEKGCYYRHEQTGRVYSAELLMNSGFDIPSLWGDFR
SFIAHFVRVK
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcgtatttgatgaaaacaagcgtgtattcaaactcgacacggaaaaatcgagc
tacgcattccatatcaccgacagcagaaacctgctccacctgtactacggcggttatatt
ccagaaacggatataactcatatgctccgcataccgaatgacgagccgtttgtgcctgcg
gtacacgacgctatgggccctcacagctttgactgtgcgcctatcgaatttcctacatcg
ggcgttgcggatttcagagaaccggcaatgcaggtaatggatataaacggtatgtccgcc
tgtgaatgctactacaaggattacagaatatcaaacggcaagccgaaattaaaggggctt
cctgctacatatgccgcagacgatgaggcgcagacgcttgaggtgttctgctacgatccg
cacagcggtcttgatattacgcttatgtacagcgttttcccgaaatttgacgttattaca
agaagcgtaaaggtcgaaaacaacggtcttgccgctatcgacctgcgccgtatcatatca
atgagccttgatcttgacagaatggactacgatatgataacactgcacggaacatgggca
agagaacgccatgtacagcgtttccctatacgtttcggcaagcagtcgatagattccaac
agaggtgctacaagccacgctcacaacaacttctttgcgctgtgcgaccacaccgcaaca
gaggacttcggcgaagcgtacggctttgctctggtgtattcgggttcgttcttaggaatg
gtagaggtaggtcagtatgaaaagacaagggctctgcttggtataaatccgtatgacttc
tcgtggcacttagagccgggagaggattttcaggcgccggaggtcatcatgacctattcc
ggcgagggcttaggtcagatgtcgagaaacttccacgatgtaatgaggaacaaccttatc
agaggaaagtggaaggatatgcgccgtcctatacttattaataactgggaagcgacctat
ttcaactttgacacggacaagctccttgatatagcaagagaggctaagaaagccggaatc
gagatgctcgtcatggacgacggctggttcggtcacagaaacgatgataaatcttccctc
ggcgactggtttgtgaacgaggacaagataaagggcggtcttaagcacctcgtagacgag
gtaaacaagataggtcttaagttcggtatatggttcgagcctgagatgataagccctgac
agcaagctgtatgcggagcatcaggactggtgtatacacattcccggcagacaccgcaca
actgtaagaagtcagcttgtacttgatttttcaagaaaagaagtgcgtgactatatctat
gagcagatgaaggctatcctttcaagcgcaaacatagaatatgtaaagtgggatatgaac
agacagctcagcgaggtcggcaacgaggtattccctcccgaaagacagcgtgagatatgg
cacagatatgtcctcggcgtatatgaaatgcaggaaagactgctgacagacttccctgac
ctgctccttgaaaactgtgcgggcggcggttcacgctttgacgcaggtatgctctactac
tctcctcagatatggacaagcgatgataccgacgctatagaaaggctcaagatacagtac
ggcacttctatgtgctatccctgctcctgcttcggggctcacgtttcggacagcccgaac
cactgtgtaggcagaattacaccttttgaaacaagaggacacgttgcgatgtcgggtacg
ttcggctatgagcttgacgttacgaggatttcggacgatgacaaatatgcgataaaggaa
cagatagaagaattcaacaagtacaatccgcttgtgagaacgggcgattattacagaatc
ggcaatccgttcgcaaacgaccgctttgacgcatggcagtttgtcgcaaaggacaagagc
gaaacgctcctcgaatatgtacaggttctcaaggagccgagcgtattcctgcacagagta
aagctgaaggggcttgaaaagggctgttattacaggcacgagcagacgggaagggtttat
tcggcagagcttctgatgaacagcggatttgacattccgtcgttgtggggggatttcagg
tcgtttattgcacattttgtaagggtgaagtga

DBGET integrated database retrieval system