KEGG   Eubacterium siraeum V10Sc8a: ES1_06490Help
Entry
ES1_06490         CDS       T02589                                 

Definition
acetaldehyde dehydrogenase/alcohol dehydrogenase AdhE (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
esr  Eubacterium siraeum V10Sc8a
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:esr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ES1_06490
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ES1_06490
   00620 Pyruvate metabolism
    ES1_06490
   00650 Butanoate metabolism
    ES1_06490
  Lipid metabolism
   00071 Fatty acid degradation
    ES1_06490
  Amino acid metabolism
   00350 Tyrosine metabolism
    ES1_06490
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ES1_06490
   00626 Naphthalene degradation
    ES1_06490
Enzymes [BR:esr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ES1_06490
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ES1_06490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
712226..714883
Genome map
AA seq 885 aa AA seqDB search
MAKKQIVSNKTAESAPVSPLIVDNVDALKARMAEVRAAQQEFATFTQEQVDKIFQAAAIA
ANQMRIPLAKMAVEETGMGVVEDKVIKNNYAAEYIYNAYKNTKTCDIIEEDKAFGTMKVA
EPIGVVAAVIPTTNPTSTAIFKTLICLKTRNGIIISPHPRAKKSTIAAAKVVLDAAVAAG
APKGIIAWIDVPSLDLTNEVMRSADIILATGGPGMVKAAYSSGKPALGVGAGNTPAIIDT
TADIKLAVASIVHSKTFDNGMICASEQSVIVLDKIYDKVKKEFASLGCYFLNPEETEKVR
KTILINGALNAKIVGQKAATIAELAGVKVDPKTKVLIGEVESVDIEEEFAHEKLSPVLAM
YKAKDFEDAVAKAERLVADGGYGHTSSLYCNAVTEREKINEFANRMKTCRILVNTPSSHG
GIGDLYNFKLLPSLTLGCGSWGGNSVSENVGVKHLINIKTVAERRENMLWLRLPEKVYFK
KGSMPVALDELGTIMNKKKAFIVTDSFLYHNGNTKAITDKLDQMGISHTVFFNVAPDPTL
ACAKEGAELMKQFQPDVIIALGGGSAMDAGKIMWVLYEHPDVDFLDMAMRFMDIRKRVYT
FPKMGEKAYFVAIPTSSGTGSECTPFAVITDEKTGVKYPLADYQLLPNMAIIDTDNMMTQ
PKGLTSASGVDALTHCLEAYASIMATDYTDGLALKAAKNIFEYLPRAYAEGQTDVEAREK
MANASAMAGIAFANAFLGVCHSMAHKLGAFHHLPHGVANALLITHVMRFNAVPNPTKMGT
FSQYDHPHTLERYVEVAEFCGVTGKNNEEKFEKFIAKIEQLKETVGIKKTIKDYGIDEKD
FLDRLDAMTEQAFDDQCTGANPRYPLMSEIKQMYLNAYYGVDETV
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaagcaaatcgtaagcaacaagacagctgaatctgctcccgtaagcccgctg
atcgttgacaatgttgacgctctcaaggctcgtatggcagaagtaagagctgcacagcag
gaattcgcaacctttacacaggagcaggttgataagatcttccaggcagcagcaatcgcc
gctaaccagatgagaatcccgctcgctaagatggcagtagaagaaacaggcatgggtgtt
gttgaagataaggttatcaagaacaactacgcagctgagtacatctacaacgcttacaag
aacacaaagacctgcgacattatcgaagaagacaaggctttcggtacaatgaaggttgca
gagcctatcggtgttgttgccgcagttattcctacaacaaaccccacatcaacagctata
ttcaagacacttatctgtcttaagacaagaaacggtatcataatcagcccccaccccaga
gctaagaagagcacaatcgctgccgctaaggtagttctggacgctgcagttgctgcaggc
gcacctaagggtattatcgcctggatcgatgttccttcgctcgacctcacaaacgaagtt
atgagaagcgctgatataatcctcgctacaggcggtcccggaatggttaaggctgcttac
tcatcaggcaagcccgctctcggcgttggtgcaggtaacacacccgcaatcattgatact
acagcagacatcaagctcgctgttgcatcaatcgttcactcaaagacatttgataacggt
atgatctgtgcttctgagcagtcagtaatcgtactcgacaagatatatgacaaggttaag
aaggaatttgcatcactcggctgctacttcttaaatcccgaagaaacagaaaaggtaaga
aagacgatccttatcaacggcgcactcaacgcaaagatagttggtcagaaggccgctaca
atagctgagctcgcaggcgttaaggttgaccccaagactaaggttcttatcggtgaagtt
gaaagcgtagacatcgaagaagagtttgcacacgaaaagctctctcccgtactcgctatg
tacaaggctaaggactttgaagacgcagttgcaaaggctgaaaggctcgttgctgacggc
ggttacggtcatacatcatctctgtactgcaacgctgttacagagcgtgagaagattaac
gaattcgccaacagaatgaagacctgccgtatcctcgttaacacaccttcttcacacggc
ggtatcggtgacctttacaacttcaagcttctcccctcattaacactgggttgcggctca
tggggcggtaactccgtatccgaaaacgttggtgttaagcacctcatcaacatcaagaca
gtcgctgagaggagagagaatatgctgtggctgagacttcctgagaaggtttacttcaag
aagggttctatgcctgttgctcttgatgagctgggcacaataatgaacaagaagaaggca
ttcatcgtaacagactccttcttatatcataacggcaacacaaaggctatcacagataag
ctcgatcagatgggcatttctcatacagtattcttcaacgttgctcccgatcctacgctt
gcttgcgctaaggaaggtgcagagctgatgaagcagttccagcccgacgttatcatcgca
ctcggcggcggttctgctatggacgcaggtaagatcatgtgggtactttacgagcatccc
gatgttgacttcctcgatatggctatgagattcatggatatccgtaagagagtttacaca
ttccccaagatgggcgaaaaggcttacttcgtagctatccccacttcttcaggtacaggc
tctgagtgtactcctttcgcagttattactgacgaaaagacaggcgttaagtatcctctt
gctgactatcagttactgcccaacatggcaatcattgatacagacaacatgatgacacag
cctaagggtctgacaagtgcttcaggtgttgacgcactcacacactgcctcgaagcttac
gcatcgatcatggctacagactacacagacggtcttgctctcaaggctgcaaagaatatc
ttcgagtatctgcccagagcttacgctgaaggtcagacagatgttgaagcaagagagaag
atggctaatgcttctgctatggcaggtatcgcattcgctaacgcattcctcggtgtttgc
cactcaatggctcacaagctcggtgctttccaccacctgcctcacggtgttgcaaacgct
ctgcttatcacacacgttatgcgtttcaacgcagttcccaaccccacaaagatgggtaca
ttctcacagtatgatcacccccatactcttgagagatacgttgaagttgctgaattctgc
ggcgtaacaggtaagaacaacgaagagaagttcgagaagttcatcgctaagattgaacag
ctcaaggaaactgtaggcatcaagaagacaatcaaggactacggtattgatgagaaggac
ttcttagacagacttgacgctatgacagagcaggcattcgacgaccagtgcacaggcgct
aaccccagatacccgctgatgagcgagatcaagcagatgtacctcaatgcttactacggc
gttgacgaaacagtttaa

DBGET integrated database retrieval system