KEGG   Eubacterium siraeum V10Sc8a: ES1_08150Help
Entry
ES1_08150         CDS       T02589                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
esr  Eubacterium siraeum V10Sc8a
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:esr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
911851..913359
Genome map
AA seq 502 aa AA seqDB search
MELKRSSGVLLHITSLPANEGIGTLGKPAFEFVNWLKAAGQKYWQVLPIHPTGYADSPYQ
SPSAFAGNPLLIDLWELVELGLLVPDDIKGREYGEDPSTVDYEKVIAQKKELLHKAFFSF
KEDVSYLAFIQEQSWWLEDYALFMAIKQHNELRSWMTWDKELRFRKPEVLAAFKEEHIED
IKFHRFVQYMFFTQWNKLKAYANKNGISIIGDIPIYAAMDSADVWVNPKLFTIDISLRPT
LVAGVPPDYFSPTGQLWGNPLYDWDAMERDGYNWWLSRIDHAMKLYDMVRIDHFRAFDTY
YAIPADATTAEYGEWKKGPGMKLFDTVREKLGDVNIIAEDLGDIFDSVKKLLSDTGFPGM
RVLQFGFNSEGKDSIHLCHNYVNNCVAYTGTHDNDTIMGWLKSADAKAAKMAKSYINANF
LEHKNVSFIRSVYASPAALAIIPMQDILGIDGRGRMNVPSTVGGNWTWRMKKPANKKSAR
LMNKLTTAYLRKPSVTANAKDK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggaacttaaacgcagcagcggagtattacttcatataacaagcctccctgcaaacgag
ggcataggaacactcggaaaacctgcctttgagtttgtgaactggctgaaagcggcaggg
cagaaatactggcaggtactaccgatacacccgacaggctatgccgattcaccctatcag
tcaccgtcggcattcgcaggaaacccactgcttatagacctgtgggagcttgtagagctg
ggacttcttgtgcccgatgacataaagggcagagaatacggcgaggacccgtccacagta
gattatgaaaaggtgatcgcacagaaaaaagagcttctccacaaggcgtttttctcgttc
aaggaggacgtttcctatcttgcctttattcaggagcagagctggtggcttgaggactat
gcgctttttatggcgataaaacagcataacgaactgcgttcgtggatgacatgggacaag
gagttacgcttcagaaagcccgaagtgcttgccgcattcaaggaagagcatatagaggac
atcaaatttcaccgtttcgtacagtacatgttctttacccagtggaacaagctgaaagca
tacgccaacaagaacggcatatccataataggcgacattccgatatatgccgcaatggac
agtgcggacgtgtgggtaaacccgaaattgttcacgatagatatttcgctaagacctact
cttgttgcaggagtaccgcccgattatttctcacctacaggacagctgtggggaaatccg
ctgtatgactgggacgctatggagcgtgacggctataactggtggctgtcaagaatagac
cacgcaatgaagctgtatgatatggtgagaatagaccacttccgtgcgtttgacacttat
tatgctattcctgccgatgcaacaacagccgaatacggcgagtggaaaaaaggccccggt
atgaagctgttcgacacggtcagggaaaagctgggcgatgtcaatatcatagcggaggat
ctgggcgatatattcgacagcgtaaaaaagcttctcagcgatacgggcttccccggtatg
agagttttacagttcggcttcaacagcgaaggcaaggacagtattcacctgtgccataac
tatgtaaataactgcgtagcgtatacaggcacacacgataacgatactataatgggctgg
cttaaatcagcagatgcgaaagccgcaaagatggcaaagagctacataaacgcaaacttt
ctggagcataagaacgtcagcttcataagaagcgtttacgcaagccctgccgcacttgcg
ataattccgatgcaggacattctcggcatagacggcaggggacgtatgaatgttccctcg
actgtcggaggaaactggacgtggagaatgaaaaagcccgcaaataaaaaatccgcacgt
cttatgaataagcttacaacagcttatctcagaaagccgtcggtaacagcaaatgcaaag
gacaaataa

DBGET integrated database retrieval system