KEGG   Eubacterium siraeum V10Sc8a: ES1_11140Help
Entry
ES1_11140         CDS       T02589                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
esr  Eubacterium siraeum V10Sc8a
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:esr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ES1_11140
Enzymes [BR:esr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     ES1_11140
Exosome [BR:esr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ES1_11140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1237867..1239957
Genome map
AA seq 696 aa AA seqDB search
MAINVPKEYEVPLYLFHQGKNAEAYKLFGSHFAEKDGVRGVVFRVWAPKAADVSVVGDFN
HWNREESYMKKISDGGIWELFIPGLKKFDNYKYSIKTERGQIKLKADPYGYHMETRPNTA
SKVYDISGYNWKDSKWMDEKKTKDVYRSPMNIYEVHLNSWFTKTDEEELFSYMQLAEKLV
PYVKEMGYTHIEMMPIAEFPFDGSWGYQQIGYYAPTSRFGTPSDFMEFVDYCHTHGVGVI
LDWVPAHFPKDAAGLYEFDGDYCYEYSDPNKREHYNWGTRVFDWGKPEVQSFLISNANYW
LSEYHIDGLRVDAVASMLYLDYDRQGGAWTPNKNGGNENLEAVDFLQNLNSCLFSRHPGL
LMIAEESTAWPMVTKPVDIGGLGFNFKWNMGWMNDMLSYMSMSPEYRQYNHDKLTFSFYY
AFSENYILPISHDEVVYGKCSMLDKMSGPREKRFASLRTFLAYMTAHPGKKLMFMGQEFA
QFKEWNYKTGLDWDILKFPEHSQYQSFVKAMNKFYLDNKPLWEIDYDWSGFSWISNDDNK
NSVIVFRRIASNGDELIAVCNFLPNEHEQYRFGVPYYADYKEVFTTDDKKFGGDSDGNAS
YTAQCEGMHGLEYSITMKIPAMSAVFLKPVNKRSPESDKPKPKKAEKPAKTAEKKAETQA
QKTAQKTAAKPGASAKKPAAKKANTANRKKNGKAKK
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atggctattaatgtgcctaaggaatatgaagttcccctttatcttttccatcagggaaag
aacgccgaagcatataagctgtttggctctcattttgccgaaaaagacggcgtgagaggc
gttgttttcagagtatgggcaccaaaggctgctgatgtcagcgtcgtaggtgatttcaat
cactggaaccgtgaagaaagctatatgaaaaaaatcagcgacggcggtatttgggagctt
tttatccccggactcaagaagtttgataattacaaatacagcataaagaccgaaagagga
cagataaagctgaaggccgatccctacggttatcatatggaaacacgtccaaataccgct
tcaaaggtgtatgatatttccggctacaactggaaagattcaaagtggatggatgagaag
aagacgaaggacgtataccgttctcctatgaatatatacgaggtacacctcaactcgtgg
tttacaaagaccgatgaggaggagctgttcagctatatgcagcttgcagaaaagctcgtt
ccttatgtcaaggaaatgggttatacccatatcgagatgatgcctatagccgagttcccg
tttgacggttcgtggggataccagcagataggctattacgctcccacatcacgtttcggc
actccctctgattttatggaatttgtagattactgccacactcacggagtaggcgttatt
ctcgactgggtaccggcacatttccccaaggatgcggcaggactttacgagtttgacggc
gattactgctatgaatattccgaccccaacaagcgtgagcattataactggggtacaaga
gttttcgactggggcaagcccgaggtgcagtcgttccttatttcaaatgctaactactgg
ctttccgaatatcatatagacggtctgcgtgtcgatgcggtagcttctatgctttacctt
gactatgacaggcagggaggagcgtggacgcccaacaagaacggcggaaacgagaatctt
gaggctgtcgatttccttcagaacctcaactcctgccttttctcacggcacccgggactt
ctgatgatagcggaagaatcgaccgcatggcctatggttacaaagcctgtcgatattggc
ggtcttggcttcaacttcaagtggaatatgggctggatgaacgatatgctttcgtatatg
tcaatgagccccgagtacagacagtacaaccatgacaagctgaccttctcgttctattac
gcattctccgaaaactacatactgccgatctcacacgatgaggtggtttacggcaagtgt
tcaatgcttgacaagatgagcggaccgagagaaaagcgtttcgcatctctcagaacgttc
cttgcatatatgacagcacaccccggtaagaagctgatgttcatgggtcaggaattcgca
cagttcaaggaatggaattacaagacaggtcttgactgggatattctgaaattccccgag
cattcacagtatcagtcgttcgtaaaggctatgaacaagttctatctcgacaacaagcct
ttatgggagattgattatgattggagcggcttcagctggatttcaaacgatgacaacaag
aacagcgtcatagtattcagacgtattgcatcaaacggtgacgagcttatcgcagtatgc
aacttcctgccgaatgaacacgagcagtacagattcggcgttccttattatgccgactat
aaggaagtgttcacgacagatgataagaagttcggcggcgacagcgacggcaacgcttca
tatactgcacagtgcgagggtatgcacggacttgagtattcaataacaatgaagataccc
gcaatgtccgcagtattcctaaagcccgtcaacaagcgcagccccgaaagcgacaagcca
aagcccaaaaaggcggaaaagcctgcaaaaaccgcagagaaaaaggctgaaacacaggcg
cagaaaacggcgcagaaaaccgccgcaaagcccggagcttccgcaaagaaaccggcggca
aagaaagcaaatacggcgaaccgtaagaaaaacggcaaagctaagaaataa

DBGET integrated database retrieval system