KEGG   Eubacterium siraeum V10Sc8a: ES1_11320Help
Entry
ES1_11320         CDS       T02589                                 

Definition
Cellulase M and related proteins (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
esr  Eubacterium siraeum V10Sc8a
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:esr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1257386..1258411)
Genome map
AA seq 341 aa AA seqDB search
MAELFENIKRLCLADGTSGDEGDVTKLILSMLPQECDAKIDPLGNIIVNKKGAETPKNKV
MLAAHQDEVGFIVTYITDDGNLKFTTVGGINPEVVIGRQLHFKNGTVGVVGGKAIHQQSP
KERDEPVKLDTLTIDIGASSKAEAEKYVSPGDCAYFRSDYTELGNGYLREKALDDRIGCA
IMVDILNKNLPYDVTCVFTVQEEIGTRGAKVAAYTVKPDYAIVLETTTACDFSGNDGEKR
VCELGKGCVVSYMDRSTIYDRELYRLGFEKAKEINVPCQTKTLVAGGNDSGAIHSSVGGI
RTVALSVPCRYLHSPSCMIKKSDVQSTAELAYAMYLALAKK
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattgtttgagaatataaaaaggctgtgtcttgccgacggtacgagcggtgat
gagggcgatgtaacaaagctgatactttcaatgctgccgcaggagtgcgatgcaaaaatc
gacccactgggcaacatcatagtaaataaaaagggtgctgagaccccgaaaaacaaggtt
atgcttgccgcccatcaggacgaggtcggatttatcgtgacctacatcaccgatgacgga
aatcttaaatttacaactgtcggcggtatcaatccagaagtagttatcggcagacagctt
cacttcaaaaacggcactgtcggagtagtcggcggcaaggcgatacaccagcagtcgccc
aaagagcgtgacgaaccggtaaagctcgatacgctgacaatagacatcggtgcttcatca
aaggcggaagcggaaaaatacgtttctcccggtgactgcgcatatttcagaagcgattat
accgaacttggcaacggctatctgcgtgagaaagcgcttgacgacaggataggctgtgcc
ataatggtagatatactgaataagaatctgccgtatgacgttacctgcgtgtttactgtg
caggaggagataggtacgagaggcgcaaaggttgccgcttatacggtaaagccggattac
gctatcgtccttgaaaccaccacagcctgcgacttttcgggcaatgacggtgaaaagcgt
gtatgcgagcttggcaagggctgtgtagtaagctatatggacagaagtacgatatatgac
cgtgagctgtatcggctcggctttgaaaaggcaaaggagataaacgttccctgccagaca
aagacgcttgtagcaggcggcaacgacagcggcgcaatccattcatctgtcggcggtatc
agaacggtcgcactatccgttccgtgcaggtatctgcactcgccgtcgtgtatgataaag
aaaagcgatgtgcaaagtaccgctgagcttgcgtatgcaatgtatcttgcgcttgcgaaa
aaatga

DBGET integrated database retrieval system