KEGG   Eubacterium siraeum V10Sc8a: ES1_11320Help
Entry
ES1_11320         CDS       T02589                                 

Definition
Cellulase M and related proteins (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
esr  Eubacterium siraeum V10Sc8a
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ES1_11320
Enzymes [BR:esr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     ES1_11320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1257386..1258411)
Genome map
AA seq 341 aa AA seqDB search
MAELFENIKRLCLADGTSGDEGDVTKLILSMLPQECDAKIDPLGNIIVNKKGAETPKNKV
MLAAHQDEVGFIVTYITDDGNLKFTTVGGINPEVVIGRQLHFKNGTVGVVGGKAIHQQSP
KERDEPVKLDTLTIDIGASSKAEAEKYVSPGDCAYFRSDYTELGNGYLREKALDDRIGCA
IMVDILNKNLPYDVTCVFTVQEEIGTRGAKVAAYTVKPDYAIVLETTTACDFSGNDGEKR
VCELGKGCVVSYMDRSTIYDRELYRLGFEKAKEINVPCQTKTLVAGGNDSGAIHSSVGGI
RTVALSVPCRYLHSPSCMIKKSDVQSTAELAYAMYLALAKK
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattgtttgagaatataaaaaggctgtgtcttgccgacggtacgagcggtgat
gagggcgatgtaacaaagctgatactttcaatgctgccgcaggagtgcgatgcaaaaatc
gacccactgggcaacatcatagtaaataaaaagggtgctgagaccccgaaaaacaaggtt
atgcttgccgcccatcaggacgaggtcggatttatcgtgacctacatcaccgatgacgga
aatcttaaatttacaactgtcggcggtatcaatccagaagtagttatcggcagacagctt
cacttcaaaaacggcactgtcggagtagtcggcggcaaggcgatacaccagcagtcgccc
aaagagcgtgacgaaccggtaaagctcgatacgctgacaatagacatcggtgcttcatca
aaggcggaagcggaaaaatacgtttctcccggtgactgcgcatatttcagaagcgattat
accgaacttggcaacggctatctgcgtgagaaagcgcttgacgacaggataggctgtgcc
ataatggtagatatactgaataagaatctgccgtatgacgttacctgcgtgtttactgtg
caggaggagataggtacgagaggcgcaaaggttgccgcttatacggtaaagccggattac
gctatcgtccttgaaaccaccacagcctgcgacttttcgggcaatgacggtgaaaagcgt
gtatgcgagcttggcaagggctgtgtagtaagctatatggacagaagtacgatatatgac
cgtgagctgtatcggctcggctttgaaaaggcaaaggagataaacgttccctgccagaca
aagacgcttgtagcaggcggcaacgacagcggcgcaatccattcatctgtcggcggtatc
agaacggtcgcactatccgttccgtgcaggtatctgcactcgccgtcgtgtatgataaag
aaaagcgatgtgcaaagtaccgctgagcttgcgtatgcaatgtatcttgcgcttgcgaaa
aaatga

DBGET integrated database retrieval system