KEGG   Eubacterium siraeum V10Sc8a: ES1_11330Help
Entry
ES1_11330         CDS       T02589                                 

Definition
(GenBank) Cellulase M and related proteins (EC:3.2.1.4)
Organism
esr  Eubacterium siraeum V10Sc8a
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1258404..1259432)
Genome map
AA seq 342 aa AA seqDB search
MTMDINSMLYRLCSVDGVSGDERSASEIALSMLESYTDDCSIDDFGNVIGHIKSTGNKPK
LLLDAHIDRVGLIVSFIDDNGFIKVGAVGGPDRRVLAAQSVTIHGKEKVKGVVSVLPPHV
KSGDGVPKIEEIVIDTGYTKQELESRIELGDRITFDCEPVAMLGTRYCAGALDDRCGVAS
ILVALEMLKSNELAFDLDVSFTTQEETGESGAKIAVYDLDPDYILEMDVSFAKTPDSDRA
KCADMSKGVMIGIAPSLSRELSGRLISLAKSENIPYQLEVMGGKTGTNADTMSVNKSGAK
ACTLSIPLKFMHTPAEIIDTDDVISTAKLITAFATKGGAENG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgacaatggatattaacagtatgctgtaccgtctgtgcagtgttgacggtgtttcgggc
gatgaaagaagtgcgtccgaaattgcactgtcaatgcttgaaagctacacggacgactgc
agtattgacgatttcggcaacgttatcggacatataaaaagtacgggcaacaagccgaag
cttctgcttgacgcacatatcgacagggtgggacttatcgtatcgtttattgacgataac
ggctttataaaggtcggtgcggtaggcggtcctgacagacgtgtgcttgcggcgcagagc
gtgacgattcatggcaaggaaaaggtgaagggcgttgtatccgttcttccgccccatgta
aagagcggcgacggagtgcctaaaattgaggaaatcgttatagacacgggctatacaaag
caggaacttgaaagccgtattgagcttggcgacaggataaccttcgactgtgagcctgtg
gctatgctcggcacaagatactgtgcaggtgcgcttgacgacaggtgcggagtagcttct
atactggttgctctcgaaatgcttaaaagcaatgagcttgcgtttgaccttgatgtatcg
tttacaacgcaggaagaaacgggagagagcggtgcgaaaatagccgtatatgaccttgac
cccgactatattcttgaaatggacgtcagctttgcgaaaactcccgacagcgacagggcg
aaatgcgcagatatgtcaaagggcgttatgataggcattgcgccgtcactttcaagagag
ttgtcaggcaggctcatatcacttgcaaaatcggaaaatattccttatcagcttgaggtc
atgggcgggaaaacaggcacaaacgccgacacgatgagtgtgaacaagtcgggtgcaaaa
gcgtgtacgctgtccattccgcttaaattcatgcatactccggccgaaatcatcgacaca
gacgatgttatatccacagcaaagctgattacggcttttgccacgaagggcggtgccgaa
aatggctga

DBGET integrated database retrieval system