KEGG   Eubacterium siraeum V10Sc8a: ES1_21980Help
Entry
ES1_21980         CDS       T02589                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
esr  Eubacterium siraeum V10Sc8a
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:esr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ES1_21980
  Amino acid metabolism
   00340 Histidine metabolism
    ES1_21980
Enzymes [BR:esr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     ES1_21980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2355659..2356945)
Genome map
AA seq 428 aa AA seqDB search
MIKTIKADGSEKEFLAGMKKRSSEVNAEVEKTVRAIIDDVAARGDEAVKEYTARFDCPDM
QYYRVPDEVIQDALTNADPDFVNSMLNAQENITAFHTRQKQNGYMMTDESGCILGQRVRG
LDRVGLYVPGGTAAYPSSVLMNAIPAKIAGVGEIIMVTPPMKDGTPNNDILVAAALCGVD
KIFMCGGAQAVAALAFGTEEIPKVSKIVGPGNIFVATAKKLLYGTVDIDMIAGPSEILIV
ADDTANPKYAAADLMSQAEHDKLASSVLITTSQRVADETVKEIERQVADLSRKDIINTSL
DNCGAIIICDDMDKACEIANEIAPEHLEVLAANPLEYIGKLTNCGSLFLGEYAPEPLGDY
YAGPNHVLPTSGTARFFSPLSVDSFIKKSSYIYYTRDKLYGAKEDIVRIANRERLTAHAN
AITVRFED
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgataaagactatcaaagcagacggcagtgaaaaagaatttctcgcaggtatgaaaaag
cgcagcagtgaagtaaacgcagaggttgaaaagaccgtaagagcaattatagacgatgtt
gccgcaagaggcgacgaggctgtaaaggaatatacggcaaggtttgactgccccgatatg
cagtattacagagtacccgatgaagtcatacaggacgctctcacaaatgcagaccccgac
tttgtgaactcaatgcttaacgctcaggagaacattacggcgttccacacccgtcagaag
cagaacggatatatgatgacagacgagagtggctgtatcttaggtcagcgcgtaaggggt
cttgacagggtaggcttatatgttccgggcggcacggcggcttatccttcgtctgttctt
atgaacgctatccctgcaaagattgcaggcgtaggcgagatcattatggtaactcctcct
atgaaggacggtacgcccaacaatgatatacttgtggcggcggctctgtgcggcgttgac
aagatattcatgtgcggcggcgctcaggctgttgcggctctggcattcggcacagaggag
atacccaaggtatcaaagatagtaggtccgggaaatatcttcgtagcaaccgcaaagaag
ctcctttacggaacggttgatattgatatgatagcaggtccgagcgaaattcttatagtt
gcggacgatacggcgaaccctaaatatgccgccgctgatcttatgtcgcaggctgaacac
gacaagctggcaagctccgtgcttataacgacaagtcagcgtgttgccgatgaaacagta
aaggaaatcgaaagacaggttgcagacctttcaagaaaggatattatcaacacatctctt
gataactgcggtgcaataatcatatgcgacgatatggacaaggcttgcgagatagcaaac
gaaattgctcccgaacaccttgaggtgcttgccgcaaatccgcttgaatatataggaaag
cttacaaactgcggttcgctgttcctcggagaatatgctcccgagcctctcggcgactat
tacgcaggacctaaccacgttcttccaacaagcggtacggctagattcttctcaccgctt
tcagtggacagctttatcaagaagtcaagctatatctactatacaagagataagctgtat
ggcgctaaagaggatattgtaagaatagcaaatcgtgaaagacttacagcacacgcaaac
gctatcacggtaagattcgaggactga

DBGET integrated database retrieval system