KEGG   Eubacterium siraeum V10Sc8a: ES1_22680Help
Entry
ES1_22680         CDS       T02589                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
esr  Eubacterium siraeum V10Sc8a
Pathway
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:esr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    ES1_22680
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ES1_22680
Enzymes [BR:esr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     ES1_22680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2427704..2428279)
Genome map
AA seq 191 aa AA seqDB search
MIQKFEFKETEIKGLIEVTPFNADDIRGCFTKDYSKEVFEANGIKHDLAEVFYTTSYKGV
IRALHFQREKQQPKLVRCIHGHVYDVVVDLRKDSPTFKKWLAFELIGEKHNEILVPAGCA
HGYLVLEDSIVSYKCGEKFYGEYDDGIMWNDPDIAVDWKLDRVGGIDKVILADKDKNLQT
FKEFMSKYGGF
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgatacagaagtttgaattcaaggaaacagagattaagggacttatagaagtaactccc
ttcaatgccgatgatataagaggctgtttcacaaaggattactcgaaggaagtgttcgag
gcaaacggcataaagcacgatcttgccgaggttttctatacgacaagctacaagggcgtt
atccgtgcacttcattttcagcgtgagaaacagcagcccaagctggtacgctgcatacac
ggacacgtttacgatgtagtagtcgatttacgcaaggacagccccacgttcaagaagtgg
cttgcatttgagcttatcggtgaaaagcacaacgaaatactcgttcccgcaggttgcgct
cacggttatcttgtacttgaggacagcatagtatcctacaagtgcggagaaaaattctac
ggcgaatatgatgacggcattatgtggaacgatcccgacattgcagtagactggaagctt
gacagagtaggcggaattgataaggtcatacttgccgacaaggacaagaatctgcagacc
tttaaagaattcatgagcaagtacggtggcttttga

DBGET integrated database retrieval system