KEGG   Eubacterium siraeum V10Sc8a: ES1_25010Help
Entry
ES1_25010         CDS       T02589                                 

Definition
Endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
esr  Eubacterium siraeum V10Sc8a
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ES1_25010
Enzymes [BR:esr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     ES1_25010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2676164..2677231)
Genome map
AA seq 355 aa AA seqDB search
MPGWNLGNQLEANSGGTPSETTWGNPTITEKLIKQVKAQGFKSIRIPVSYLSKIGAGPNY
TIDSKWLDRVQEVVDMCIDNGLYAIINIHGDGYYSIKGGWLLCGESASEQKTIKAKYKKV
WEQIAKRFKNYDEHLVFESMNEEFDGTYNTPNREYYDNINAYNRIFVDTVRKAGGKNNSR
YLLVPGWNTDINYTAGDYGFKIPNDSTGRLMISVHYYDPWKFCGGEEAPGIFRWGDSIKG
QAIRNSGEKHTDAKFDQLYDAFISKGYGVIIGEYGAIDKTYKDSRSTAYRAYFAEYVNYA
AHKRNIVTVYWDNGYNGDNGFGIFDRKKCTVTQPEIIKGIINGAKATKAPKAVTE
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgcccggctggaacctcggtaatcagcttgaggcaaactcgggcggaacaccgagcgaa
acaacgtggggcaaccccacaattaccgaaaagctcatcaagcaggtaaaggcacagggc
ttcaagtctatccgtatccccgtatcatatctttcgaagataggcgcaggccccaactac
actatcgactcaaagtggctcgacagagtacaggaagtagtcgatatgtgcattgataac
ggactttacgctataatcaacattcacggcgacggctactacagcataaaaggcggctgg
cttctctgcggcgaatccgcttccgagcagaagactataaaagcaaagtacaaaaaggtc
tgggagcagatagcaaaacgcttcaagaactatgatgaacacctcgtgttcgaatcaatg
aatgaagaatttgacggaacatacaacacacccaaccgtgaatattacgataacatcaac
gcatataaccggattttcgttgatacggtaagaaaagcaggcggcaagaacaacagccgt
tatctgcttgttcccggctggaacaccgacattaattataccgcaggcgattacggcttc
aaaatcccgaatgacagcaccggcagattaatgatttctgttcattattatgacccgtgg
aaattctgtggcggtgaagaagcaccgggcatattcagatggggcgacagcataaaaggt
caggctatccgcaacagcggtgaaaagcacacagacgctaagtttgatcagctgtatgat
gccttcatcagtaagggctacggtgtaataatcggcgagtacggcgctatagataaaacc
tataaggacagccgtagcacagcttaccgtgcttatttcgcagagtatgtgaattatgcc
gctcacaagagaaatatcgtaacggtttactgggataacggctataacggcgataacggc
ttcggtattttcgaccgcaaaaagtgtacagtaacgcagcccgaaataatcaagggtatc
ataaacggcgcaaaggcgactaaagcaccgaaggctgtgacagaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system