KEGG   Eubacterium siraeum 70/3: EUS_01560Help
Entry
EUS_01560         CDS       T02590                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
esu  Eubacterium siraeum 70/3
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:esu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EUS_01560
  Amino acid metabolism
   00330 Arginine and proline metabolism
    EUS_01560
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    EUS_01560
Enzymes [BR:esu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     EUS_01560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
159968..160753
Genome map
AA seq 261 aa AA seqDB search
MDFSSVKRIVIKVGTSTLAHNTGNLNIRRVSKLIEVMSDLKNSGKDVIFVTSGAQGVGAA
KAGLHSKPKEMPKKQACAAIGQCELMHIYDREFANYNHTVAQVLLTRDVISNKTRKENVI
NTFNTLLDMGIVPIINANDTVSIQELDFDENDTLSAIVAALCSADLLIILTDVDGLYDKN
PKLPGAKLIPEVKQITSEMISSAKDKGSEFASGGMITKLEAATIAKEHGIPTVIINGQRP
EILYDLFENKAVCTVFTADED
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggatttttcaagcgtaaagagaattgttataaaggtaggcacaagcacgcttgcccat
aacacaggcaatcttaatataagacgtgtttcaaagctgatagaggtaatgtcggatctg
aaaaattccggcaaggacgtgatatttgttacatcgggcgcacagggcgtaggtgcggca
aaggcaggacttcactcgaagcctaaagagatgccgaaaaagcaggcttgcgccgctata
ggtcagtgcgagcttatgcacatttatgaccgtgaattcgcaaactacaatcacacggtc
gcacaggtgcttcttacccgtgacgttatcagcaataagacaagaaaagagaacgttata
aacacgttcaatacgcttcttgatatgggcatagtgcctataatcaacgcaaacgatacc
gtttcgatacaggagcttgactttgacgagaacgatacgttatccgcaatagtggcggcg
ctgtgcagtgccgacctgctgataatccttaccgacgttgacggcttatatgataagaac
cctaaacttcccggtgcaaagctgattcctgaggtaaagcagataacaagcgagatgata
agctctgcaaaggacaagggcagtgagtttgcaagcggcggtatgataacaaagctcgag
gcggctactatcgcaaaggagcacggcataccgactgtaataatcaacggtcagcgtccc
gaaatactttacgatctgtttgagaataaggctgtctgcacagtattcaccgcagacgag
gactga

DBGET integrated database retrieval system