KEGG   Eubacterium siraeum 70/3: EUS_04780Help
Entry
EUS_04780         CDS       T02590                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
esu  Eubacterium siraeum 70/3
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EUS_04780
Enzymes [BR:esu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     EUS_04780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
465491..467008
Genome map
AA seq 505 aa AA seqDB search
MRKSGILLHIASLPNKYGIGTMGREAYKFVDWLRSAGQSLWQILPLSQTSFGDSPYQSFS
IYAGNPYFISLETLEEEGLLKHKEYADINWCKDPRYIDYATMYENFYKVMRLAFGRFSKD
RNGNVSEEYKAFVAENPWLENYTLFMALKDAHGGKSWCEWETPLRLRDVTAVYSAKKKYA
KDMEFYAFLQFEFFRQWYKLKKYANDNGIQIIGDIPIYCALDSADVWCEPQLFQLDRDRV
PTVVAGFPPDAFSEDGQLWGNPIYDWDRMKQENYRWWVGRMSFAKKLYDIVRIDHFIGFN
SYYAIPFGSKTAHGGEWHDGPKYDLFNVIKRETGKGGIIAEDLGIITPSVKKLLKQAAYP
GMKVLQFAFDPTGKSEYLPQNYASQNCVVYTSTHDSDTALGWFNNLDRTTKQFVKEYLGV
RHAAELPEAFIDIAWKSTADMAMTTMQELCGFGTEARINVPSTIGNNWRWRTLESDFTAK
SAAYLDRLTEISNRKPPVKKSRKKR
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaagcggtatcttactgcacattgcgtcactgccgaacaaatacggcatcggc
acgatgggcagggaagcctataaattcgttgactggctcagaagcgccggtcagagtctg
tggcagatacttccgctgtcacagacgagctttggcgattcgccgtaccagagcttttcc
atatatgccggaaatccttacttcatcagccttgagacgctggaggaggaggggcttctg
aagcataaggaatatgcggatataaactggtgcaaggatccgagatatatcgactacgcc
acgatgtacgagaacttctataaagtgatgaggctcgcattcgggcgcttttctaaggac
aggaatggtaacgtttccgaagaatataaggcattcgttgccgaaaatccgtggcttgag
aattacacgctgttcatggcgctgaaggacgcacacggaggaaaaagctggtgcgagtgg
gaaacgccgcttcgcctgcgtgatgtaacggcggtatattccgcaaagaagaagtacgca
aaggatatggaattctacgcattccttcagttcgagttcttccgtcagtggtacaagctg
aagaagtatgcaaatgacaacgggatacagattatcggcgatattccgatatactgcgcc
cttgacagtgcggatgtctggtgcgaaccgcagctgtttcagcttgaccgtgacagagtg
cctaccgtcgttgcgggattccctccggacgcattctctgaggacgggcagttgtgggga
aatcccatctatgactgggacagaatgaagcaggaaaactatcgctggtgggtcggcaga
atgagcttcgcaaagaagctgtatgatattgtccgtatagatcacttcatcggtttcaac
agctactatgccatcccgttcggcagcaagaccgcacacggcggcgagtggcacgatggt
ccgaaatacgatctgttcaatgtcattaagagagaaaccggaaagggcggtatcatagcg
gaggatctgggaataatcactccgtctgtaaagaaacttctcaagcaggcggcatatccc
ggaatgaaggtactgcagtttgctttcgaccctacgggaaagagcgagtatcttccgcag
aactacgcatcgcagaactgcgttgtgtatacatccactcacgacagcgatacggcactt
ggctggttcaacaaccttgatcgtacaacaaagcagttcgtgaaggaatatctcggggtg
cgtcatgcggctgaactgcctgaggcattcattgacatcgcctggaaaagcaccgcagat
atggctatgactacaatgcaggaactgtgcggattcggaaccgaggcacgcataaacgtt
ccttccaccatcggaaataactggcgctggaggacactggagagcgactttaccgctaag
agtgcggcatacctcgacagactgaccgaaataagcaacagaaaacctcccgttaaaaaa
tcaagaaaaaaacgataa

DBGET integrated database retrieval system