KEGG   Eubacterium siraeum 70/3: EUS_05220Help
Entry
EUS_05220         CDS       T02590                                 

Definition
Cellulase M and related proteins (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
esu  Eubacterium siraeum 70/3
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:esu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(515375..516400)
Genome map
AA seq 341 aa AA seqDB search
MAELFENIKKLCLADGTSGDEGDVTKLILSMLPQECDAKIDPLGNIVVNKKGAKTPKNKV
MLAAHQDEVGFIVTYITDDGNLKFTTVGGINPEVVIGRQLHFKNGTVGVVGGKAVHQRSP
KERDEPVKLDTLTIDIGASSKAEAEKYVSPGDCAYFRSDYTELGNGYLREKALDDRIGCA
IMVDILNKNLPYDVTCVFTVQEEIGTRGAKVAAYTVKPDYAIVLETTTACDFSGNDGEKR
VCELGKGCVVSYMDRSTIYDRELYRLGFEKAKEINVPCQTKTLVAGGNDSGAIHSSVGGI
RTVALSVPCRYLHSPSCMIKKSDVQSTAELAYAMYLALAEK
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattgtttgagaatataaaaaagctgtgtcttgccgacggtacgagcggtgat
gagggcgatgtaacaaagctgatactttcaatgctgccgcaggaatgcgacgcgaaaatc
gacccactgggcaacatcgtagtaaataaaaagggcgctaagaccccgaaaaacaaggtt
atgctcgccgctcatcaggacgaggtcggatttatcgtgacctacatcaccgatgacgga
aatcttaaatttacaactgtcggcggtatcaatcccgaagtagtaatcggcagacagctg
cacttcaaaaacggcactgtcggagtagtcggcggcaaggcggtacatcagcgttcgccc
aaagagcgtgacgaaccggtaaagctcgatacgctgacaatagacatcggtgcttcatca
aaggcggaagcggaaaaatacgtgtctcccggtgactgcgcatatttcagaagcgattat
accgagcttggcaacggctatctgcgtgagaaagcgcttgatgacaggataggctgtgcc
attatggtagatatactgaataagaatctgccgtatgacgttacctgcgtgtttactgtg
caggaggagataggtacgagaggcgcaaaggttgccgcttatacggtaaagccggattac
gctatcgtccttgaaaccaccacagcctgcgacttttctggcaatgacggtgaaaagcgt
gtatgcgagcttggcaagggctgtgtagtaagctatatggacagaagtacgatatatgac
cgtgaactgtatcggctcggctttgaaaaggcaaaggagataaacgttccctgccagaca
aagacgcttgtagcaggcggtaacgacagcggcgcaatccattcatctgtcggcggtatc
agaacggttgcactatccgttccgtgcaggtatctgcactcgccgtcgtgtatgataaag
aaaagcgatgtgcaaagtaccgctgagcttgcgtatgcaatgtatcttgcgcttgcggaa
aaatga

DBGET integrated database retrieval system