KEGG   Eubacterium siraeum 70/3: EUS_07800Help
Entry
EUS_07800         CDS       T02590                                 

Definition
Endoglucanase
Organism
esu  Eubacterium siraeum 70/3
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
789882..791234
Genome map
AA seq 450 aa AA seqDB search
MKRKVLKSLIALASTVSMLAGCAQSAVTSGENASGGTSATSQSQNVSSYADIKAESSVTS
TSSTTAAEHTSKSTESSTDTTKASENKPSQIAGKMRNITSQQLVEDMTFGWNLGNTLDVC
QADRDGDGKINEHVEAGEKVDETLWGNPKATKELFTSLKKNGVNAVRIPVTWRDHMDSNG
NIDREWMDRVQQVVDYAYSQGMYVIINVHHDGGGDPKFGAWIIEESQKDYNTFLKKYKNI
WKQIAERFKNYSDYLIFESMNEVGFDTLYNKNKADAYNLINKINQDFVDIIRATGGNNAK
RHLLIAGYYTDIERTCDSLYKMPDDKAGRCILSVHYYTPWDFCTCDRKHTWGTNSEVRQM
ETLIGKMKKNFVDKGIPVIIGEYAASGSDLSSCIFFIEKLNKLCSDYGIATFIWDSGSQV
NRKTYKWRTPQYLEALKRATSGKDYEVVKE
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaaagtattgaagtcattaattgcacttgcatcgactgtatcaatgcttgca
ggatgtgcgcagagtgcggtaacaagcggtgaaaatgcttccggaggaacatctgctaca
tcgcaatcacagaatgtgagcagttatgcagacatcaaagctgaaagctctgtgacaagc
acgtcttcgacaactgcggcagagcatacatctaagtcaaccgaaagcagtaccgataca
acgaaagcaagtgagaataagccttcacagatcgcaggaaagatgagaaatataacttca
cagcaactggttgaagatatgacgtttggctggaacctcggtaatacgcttgatgtttgt
caggctgaccgtgacggcgacggtaagataaacgagcatgttgaagcgggagaaaaggtt
gatgaaacgctgtggggcaatcctaaagccacaaaagagctgttcacatcactgaaaaag
aacggcgtaaatgcggtgcgtatacctgtgacgtggagagatcatatggattccaatggc
aacatagatagggaatggatggacagggtacagcaggtagtcgattatgcatactcgcag
ggaatgtatgttattataaatgtacatcacgacggcggcggtgatcctaagttcggtgca
tggataatcgaggagtcgcagaaggattataatacattcctgaagaaatacaaaaatata
tggaagcagatagcagagagattcaaaaactattcggactatctgattttcgagtcgatg
aacgaggtcggatttgatacgctttacaataaaaataaggcggacgcatataatctgata
aataagattaatcaggattttgttgacataatccgtgcgacaggcggaaacaatgcaaag
cgtcatctgcttattgcgggatattatacggatatagagcgcacctgcgattcgctttat
aaaatgcctgacgacaaagcgggcagatgtatcctgtcggtacattactacacaccgtgg
gatttctgcacctgcgatagaaagcacacatggggtacaaattcggaagtccggcaaatg
gaaacgcttatcggcaagatgaaaaagaacttcgttgacaagggaatacccgtaataatc
ggtgaatatgcggcaagcggaagcgatctttcttcctgtatattctttatagaaaagctg
aacaagctgtgcagtgattacggtatagcaacgtttatatgggatagcggcagccaggta
aacaggaagacatacaagtggagaactccgcagtatcttgaggcattaaagcgtgcaaca
agcggcaaggactacgaagtagtcaaggagtga

DBGET integrated database retrieval system