KEGG   Eubacterium siraeum 70/3: EUS_07800Help
Entry
EUS_07800         CDS       T02590                                 

Definition
(GenBank) Endoglucanase
  KO
K01179  
endoglucanase [EC:3.2.1.4]
Organism
esu  Eubacterium siraeum 70/3
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EUS_07800
Enzymes [BR:esu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     EUS_07800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
789882..791234
Genome map
AA seq 450 aa AA seqDB search
MKRKVLKSLIALASTVSMLAGCAQSAVTSGENASGGTSATSQSQNVSSYADIKAESSVTS
TSSTTAAEHTSKSTESSTDTTKASENKPSQIAGKMRNITSQQLVEDMTFGWNLGNTLDVC
QADRDGDGKINEHVEAGEKVDETLWGNPKATKELFTSLKKNGVNAVRIPVTWRDHMDSNG
NIDREWMDRVQQVVDYAYSQGMYVIINVHHDGGGDPKFGAWIIEESQKDYNTFLKKYKNI
WKQIAERFKNYSDYLIFESMNEVGFDTLYNKNKADAYNLINKINQDFVDIIRATGGNNAK
RHLLIAGYYTDIERTCDSLYKMPDDKAGRCILSVHYYTPWDFCTCDRKHTWGTNSEVRQM
ETLIGKMKKNFVDKGIPVIIGEYAASGSDLSSCIFFIEKLNKLCSDYGIATFIWDSGSQV
NRKTYKWRTPQYLEALKRATSGKDYEVVKE
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaaagtattgaagtcattaattgcacttgcatcgactgtatcaatgcttgca
ggatgtgcgcagagtgcggtaacaagcggtgaaaatgcttccggaggaacatctgctaca
tcgcaatcacagaatgtgagcagttatgcagacatcaaagctgaaagctctgtgacaagc
acgtcttcgacaactgcggcagagcatacatctaagtcaaccgaaagcagtaccgataca
acgaaagcaagtgagaataagccttcacagatcgcaggaaagatgagaaatataacttca
cagcaactggttgaagatatgacgtttggctggaacctcggtaatacgcttgatgtttgt
caggctgaccgtgacggcgacggtaagataaacgagcatgttgaagcgggagaaaaggtt
gatgaaacgctgtggggcaatcctaaagccacaaaagagctgttcacatcactgaaaaag
aacggcgtaaatgcggtgcgtatacctgtgacgtggagagatcatatggattccaatggc
aacatagatagggaatggatggacagggtacagcaggtagtcgattatgcatactcgcag
ggaatgtatgttattataaatgtacatcacgacggcggcggtgatcctaagttcggtgca
tggataatcgaggagtcgcagaaggattataatacattcctgaagaaatacaaaaatata
tggaagcagatagcagagagattcaaaaactattcggactatctgattttcgagtcgatg
aacgaggtcggatttgatacgctttacaataaaaataaggcggacgcatataatctgata
aataagattaatcaggattttgttgacataatccgtgcgacaggcggaaacaatgcaaag
cgtcatctgcttattgcgggatattatacggatatagagcgcacctgcgattcgctttat
aaaatgcctgacgacaaagcgggcagatgtatcctgtcggtacattactacacaccgtgg
gatttctgcacctgcgatagaaagcacacatggggtacaaattcggaagtccggcaaatg
gaaacgcttatcggcaagatgaaaaagaacttcgttgacaagggaatacccgtaataatc
ggtgaatatgcggcaagcggaagcgatctttcttcctgtatattctttatagaaaagctg
aacaagctgtgcagtgattacggtatagcaacgtttatatgggatagcggcagccaggta
aacaggaagacatacaagtggagaactccgcagtatcttgaggcattaaagcgtgcaaca
agcggcaaggactacgaagtagtcaaggagtga

DBGET integrated database retrieval system