KEGG   Eubacterium siraeum 70/3: EUS_07970Help
Entry
EUS_07970         CDS       T02590                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
esu  Eubacterium siraeum 70/3
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:esu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EUS_07970
  Amino acid metabolism
   00340 Histidine metabolism
    EUS_07970
Enzymes [BR:esu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     EUS_07970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
811283..812569
Genome map
AA seq 428 aa AA seqDB search
MIKTIKADGSEKEFLAGMKKRSSEVNAEVEKTVRAIIDDVAARGDEAVKEYTARFDCPDM
QYYRVPDEVIQDALTNADPDFVNSMLNAQENITAFHTRQKQNGYMMTDESGCILGQRVRG
LDRVGLYVPGGTAAYPSSVLMNAIPAKIAGVGEIIMVTPPMKDGTPNNDILVAAALCGVD
KIFMCGGAQAVAALAFGTEEIPKVSKIVGPGNIFVATAKKLLYGTVDIDMIAGPSEILIV
ADDTANPKYAAADLMSQAEHDKLASSVLITTSQRVADETVKEIERQVADLSRKDIINTSL
DNCGAIIICDDMDKACEIANEIAPEHLEVLAANPLEYIGKLTNCGSLFLGEYAPEPLGDY
YAGPNHVLPTSGTARFFSPLSVDSFIKKSSYIYYTREKLYGAKEDIVRIANRERLTAHAN
AIMVRFED
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgataaagactatcaaagcagacggcagtgaaaaagaattcctcgcaggtatgaaaaag
cgcagcagtgaagtaaacgcagaggttgaaaagaccgtaagagcaattatagacgatgtt
gccgcaagaggcgacgaggctgtaaaggaatataccgcaaggttcgactgccccgatatg
cagtattacagagtacccgatgaagtcatacaggacgcactcacaaatgcagaccccgac
tttgtgaactcaatgcttaacgctcaggagaacattacggcattccacacccgtcagaag
cagaacggatatatgatgacagacgagagcggctgtatcttaggtcagcgtgtaagaggt
cttgacagagtaggcttatatgttccgggcggcacggcggcttatccttcgtctgttctt
atgaacgctatccctgcaaagattgcaggcgtaggcgagattattatggtaactcctcct
atgaaggacggtacgcccaacaacgatatacttgtggcggcggctctgtgcggcgttgac
aagatattcatgtgcggcggcgctcaggctgttgcggctctggcattcggcacagaggag
atacccaaggtatcaaagatagtaggaccgggaaatatcttcgtagcaaccgcaaagaag
ctcctttacggaacggttgatattgatatgatagcaggtccgagtgaaattcttatagtt
gcggacgataccgctaacccgaaatatgccgccgcagaccttatgtcgcaggcagagcac
gacaagctggcaagctccgtgcttataacgacaagtcagcgtgttgccgatgaaacagta
aaggaaatcgaaagacaggttgcagacctttcaagaaaggatattatcaatacctctctt
gataactgcggtgcgataattatatgcgacgatatggacaaggcttgcgagatagcaaac
gaaattgctcccgaacaccttgaggtgcttgccgcaaatcctctcgaatatataggaaag
ctgacaaactgcggttcgctgttcctcggagaatatgctccggagcctctcggcgactat
tacgcaggacctaaccacgttcttcccacaagcggtacggcgagattcttctcaccgctt
tcagttgacagctttatcaagaagtcaagctatatctactatacaagagaaaagctgtac
ggcgctaaagaggatattgtaagaatagcaaaccgtgaaagacttacagcacacgcaaac
gctatcatggtaagattcgaggactga

DBGET integrated database retrieval system