KEGG   Eubacterium siraeum 70/3: EUS_08060Help
Entry
EUS_08060         CDS       T02590                                 

Definition
Endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
esu  Eubacterium siraeum 70/3
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EUS_08060
Enzymes [BR:esu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     EUS_08060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
817352..818641
Genome map
AA seq 429 aa AA seqDB search
MFSFKKAAAGVLSCTMLLGSLVISGCSDSNTSGTQSADNTSNSSSTAHQGEIKDISSVEL
VKDMKIGWSLGNTLDAGNESNRGQDPGAIEKSWGNPDTTKEMIDEIKKAGFNVLRVPTTW
DWSTGEAPEYKISDEWFARVKEIVDYGMENDMYVILNIHHETWHYPTEDNYEAASDRLKK
VWTQIGNYFKDYDEHLIFEGLNEPRVIGTSEEWNGGSDATREVVNKLDADFVSTIRSLDG
NNKLRHLMIPGYAASSSEVALKALKIPENDDKLIVSVHAYTPYNFALADSKRSNKWVACK
EGFTNDIDYLADMLKTLFIDKGQAVIIGEFGARSKDNEKYRAEWAKYYVTKMKTVGVPCV
WWDNGAFLGSGELFGLFDRRNLEWRYPLVKDALISASNGEYTVDGLKSDTAILDELKKDI
AQSKNSSAE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgttttcatttaaaaaggcggcagcaggagtgttatcgtgtacaatgctgctcggttca
cttgtaatcagcggatgcagtgacagcaatacatcaggaacgcaatccgcagacaatacg
agcaacagctcgtcaacggctcatcagggagaaatcaaggatataagctcggttgagctt
gtaaaggatatgaagataggctggagcctcggcaacacgcttgacgcaggaaacgaaagc
aacaggggacaggatccgggagcaattgaaaaatcgtggggcaaccccgatactacaaag
gaaatgatcgacgagatcaagaaagcaggcttcaatgttttgcgtgttcccacaacgtgg
gactggagcacaggcgaagctccggagtataagataagcgacgaatggtttgcccgtgta
aaagagatagttgattacggcatggaaaacgatatgtatgttatcctcaacatacatcac
gaaacatggcactatcctaccgaggacaattacgaggcggcaagcgacaggcttaaaaag
gtatggacgcaaatcggcaattacttcaaggattatgacgagcatcttatatttgaggga
cttaatgaacccagagtaatcggtacaagcgaggagtggaacggcggcagtgatgcgaca
agagaggtcgtaaacaagctggacgctgatttcgtatctacaataagaagccttgacggt
aacaacaagctccgtcatcttatgatacccggatatgcggcatcttcatccgaagttgcg
cttaaggcacttaaaattcctgaaaacgacgataaactgattgtttccgtacacgcatat
accccgtacaactttgcactcgcggacagtaagaggtcgaacaagtgggtagcttgcaag
gaaggatttacaaacgatattgattatcttgccgatatgctgaaaactctgtttatagac
aaaggtcaggctgtcattataggcgagttcggtgcaagaagtaaggataatgaaaaatat
cgtgcagagtgggctaagtattatgttacaaagatgaaaacggtaggtgttccgtgtgta
tggtgggacaacggtgcgtttttaggaagcggcgaactgttcgggctgttcgacaggcgc
aatcttgaatggagatacccgcttgtaaaggacgctcttatttccgcatcaaacggtgaa
tatacggtagacggtcttaaatccgatacagctatccttgatgaactgaaaaaggacatt
gctcagtcgaaaaacagcagtgccgaataa

DBGET integrated database retrieval system