KEGG   Eubacterium siraeum 70/3: EUS_08510Help
Entry
EUS_08510         CDS       T02590                                 

Definition
Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
esu  Eubacterium siraeum 70/3
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:esu00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(857956..858630)
Genome map
AA seq 224 aa AA seqDB search
MYEKIKEQMVDICHKLWQKGWVAANDGNVTVKVGEGKYLATQTGVSKAFITPEKIGLIDD
DFNILEAAEGFRPSSEVKMHLRCYKERPDVGAVVHAHPPVSTGFACAHLPMDDYCMIETV
IAVGSIPLTPYGTPSTYEVPEAIAPYLKDHDCMLLENHGALTVGADLITAYYRMETMELQ
AHISLVARLLGGVKDITPDNIDRLIGMREQYGVTGKHPGYKKYL
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaaaaaattaaagaacaaatggtagacatctgccacaagctctggcagaagggc
tgggttgccgcaaatgacggcaatgtaaccgtaaaggttggcgagggtaaatatcttgct
acgcagacaggtgtcagcaaggcattcatcactcccgaaaagataggtcttattgatgat
gacttcaacatactcgaagccgctgagggcttccgtccctcgtcagaggtaaagatgcac
ctgagatgctacaaggagcgccccgacgtaggcgcagtagttcacgctcatcctcctgtt
tcaacaggctttgcgtgcgctcatctgcctatggatgattactgcatgatagaaactgta
atcgcagtaggctcaataccgctcactccctacggcacaccctcgacctacgaggtaccc
gaagcaatcgcaccttacttaaaggatcacgattgtatgctccttgaaaaccacggtgct
ctgacagtaggtgcagaccttatcacagcgtactacagaatggaaacaatggagcttcag
gctcacatttctcttgttgcacgtctgcttggcggtgtaaaggatattactcccgacaat
atcgacagacttatcggtatgagagagcaatacggcgttacaggcaagcatccgggctac
aagaaatacctttaa

DBGET integrated database retrieval system