KEGG   Eubacterium siraeum 70/3: EUS_15060Help
Entry
EUS_15060         CDS       T02590                                 

Definition
Alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
esu  Eubacterium siraeum 70/3
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:esu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    EUS_15060
  Lipid metabolism
   00561 Glycerolipid metabolism
    EUS_15060
   00600 Sphingolipid metabolism
    EUS_15060
Enzymes [BR:esu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     EUS_15060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1522096..1524213)
Genome map
AA seq 705 aa AA seqDB search
MKRININENKINIVFDIEDNGQIKLMHFSALPFNENDIWNEMFEKDHLGCFDIAQVEIAG
LDRPCERHGTKYIVTAPGYRLKYKDFSDTRDNIGRLIKVTQYDEPTGIEVISTFRFYDGI
SIVRTYTEVRNTSATETYTLTYVSSFNYLGFEKEGILPRDDKFIIKIPHNSWQKEMLWQD
YTFEQLGMPQSQKDGWEHCGKAINVTNVGNWSTNEYLPMGYIQNTETGNGLFWQIEHNGL
WHWEISDQRGHFYLALSGPNEQQSHWFKNLAPGESFTSVPVAVGVCRDFDEGMGELTRYR
RAIRRKNTDNEKLAVIFNDYMNCLWGDPTEEKEMPLIKAAAEAGCEYYCIDCGWYADGFW
WDSVGEWQENRRRFPNGLKKVTDEIRKYGMIPGVWLEIEVMGINCEMAKKVPDEWFFMRH
GKRVYDRSRYQLDFSNPEVSAYADSVIDRLVKDYGVGYIKMDYNIEPGIGTEINCDSVGE
GLMRHEKAYLAWLDGVFARYPELIIENCSSGGMRIDYAMLSRYSIQSTSDQDDYRRYATI
AANAPTGLCPEQSAIWSYPLTDGDREEVVFNMVNAMTQRIHQSGHLANLSPERMSLVKEA
LECYKSIRDDIKRSVPFWPLGLSHIGDEWVTLGLKAGNKAYLAVWRRQGSNECCNIPIRY
ATENAKVNCIYPSFDEGGHKFNPLSRSLSVKLPECFTARLFEIEL
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggataaacataaacgagaataaaatcaacattgtatttgatattgaggataac
ggacagataaagctgatgcacttttcggcgctcccgttcaacgaaaatgatatatggaac
gagatgttcgaaaaggatcatctcggctgttttgacatagcacaggtcgaaatagcggga
cttgaccgtccgtgtgaacgtcacggcacgaagtacatagtaacggcacccggctacaga
ctcaagtacaaggatttttcggatacccgtgacaatatcggcagacttataaaggtaacg
cagtatgacgagccgacgggcatagaagtaatcagcacgttccgtttctatgacggcata
agcatagtacgcacctatacggaagtcagaaatacgtctgcgaccgaaacatacacgctg
acctatgtttcatcgttcaactatctcggttttgaaaaagagggcattcttccccgtgat
gataagtttattataaagataccgcataattcgtggcagaaggaaatgctgtggcaggac
tatacctttgaacagcttggtatgccgcagtcgcagaaagacggctgggaacactgcggc
aaggcgataaatgtaacaaatgtaggtaactggtcaacaaacgaatatctacctatgggt
tatattcagaacactgaaacaggaaacgggcttttctggcagatagagcataacggcttg
tggcactgggagataagcgaccagagaggacatttttaccttgcgctcagcggacctaac
gaacagcaatctcactggttcaagaaccttgctcccggggaaagctttacgtcagttcct
gttgcagtcggcgtatgccgtgactttgacgagggtatgggcgagcttacaagataccgc
cgtgcgatacgcagaaagaataccgataacgaaaagctggcggttattttcaacgactat
atgaactgcctttggggcgaccctaccgaagaaaaggaaatgccgcttataaaagccgcc
gcagaagcaggatgcgagtattactgcattgattgcggctggtatgcggacggtttctgg
tgggacagcgtgggcgagtggcaggaaaaccgccgccgcttcccgaacggtcttaaaaag
gtgaccgatgaaatcaggaaatacggtatgataccgggcgtatggcttgagatagaagtt
atgggcataaactgcgaaatggcaaagaaagtgcctgacgaatggttctttatgcggcac
ggcaagcgtgtatacgatcgttcacgctatcagcttgacttttcaaatcccgaagtcagt
gcttatgccgacagcgtaattgaccgccttgtaaaagattacggtgtaggctacataaaa
atggactacaatatagaaccgggcataggtacggagattaactgtgacagtgtcggtgaa
ggacttatgcgacacgaaaaggcatatcttgcgtggcttgacggcgtgtttgcacgttat
ccggagcttatcatagaaaactgctcaagcggcggtatgagaatagactatgctatgctc
agccgttattcgatacagtcgacgagcgatcaggacgattacagaagatatgctacaata
gcggcaaacgcaccgacaggtctttgccccgaacagagcgctatatggtcatatccgctg
acagacggcgatagggaagaggttgtgttcaatatggtaaacgctatgacacagcgtatc
catcagagcggacaccttgcaaatctcagccccgagcgaatgtcacttgtaaaagaagcg
cttgaatgttataaaagtattcgtgatgatatcaagagatcggtaccgttttggcctttg
ggattatctcatatcggtgacgaatgggtaacactgggtcttaaagcaggaaataaagcc
tatcttgcggtttggcgcagacaaggaagcaacgagtgctgtaatataccgataagatat
gcaacggagaatgcaaaggtgaactgcatatacccgtcctttgacgagggcgggcataaa
ttcaatccgctttcaaggtcgctttctgtaaaactgcccgaatgcttcacggcaaggctt
tttgaaatagaattgtaa

DBGET integrated database retrieval system