KEGG   Eubacterium siraeum 70/3: EUS_22510Help
Entry
EUS_22510         CDS       T02590                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
esu  Eubacterium siraeum 70/3
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EUS_22510
Enzymes [BR:esu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     EUS_22510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2328590..2330098)
Genome map
AA seq 502 aa AA seqDB search
MELKRSSGVLLHITSLPANEGIGTLGKPAFEFVNWLKAAGQKYWQVLPIHPTGYADSPYQ
SPSAFAGNPLLIDLWELVELGLLAPDDIKGREYGEDPSTVDYEKVIAQKKELLRKAFFSF
KEDVSYLAFIQEQSWWLEDYALFMAIKQHNELRSWMTWDKELRFRKPEVLAAFKEEHIED
IKFHRFVQYMFFTQWNKLKAYANKNGISIIGDIPIYAAMDSADVWVNPKLFTIDISLRPT
LVAGVPPDYFSPTGQLWGNPLYDWDAMERDGYNWWLSRIDHAMKLYDMVRIDHFRAFDTY
YAIPADATTAEYGEWKKGPGMKLFDTVREKLGDVNIIAEDLGDIFDSVKKLLSDTGFPGM
RVLQFGFNSEGKDSIHLCHNYVNNCVAYTGTHDNDTIMGWLKSADAKAAKMAKSYINANF
LEHKNVSFIRSVYASPAALAIIPMQDILGIDGRGRMNVPSTVGGNWTWRMKKPANKKSAR
LMNKLATAYLRKPSVTANAKDK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggaacttaaacgcagcagcggagtattacttcatataacaagcctccctgcaaacgag
ggcataggaacactcggaaaacctgcctttgagtttgtgaactggctgaaagcggcaggg
cagaaatactggcaggtacttccgatacacccgacaggctatgccgactcaccctatcag
tcaccgtcggcatttgcaggaaacccactgcttatagacctgtgggagcttgtagagctg
gggcttcttgcacccgatgacataaagggcagagaatacggcgaggacccgtccacagta
gattatgaaaaggtaatcgcacagaaaaaggagcttctccgtaaggcgtttttctcgttc
aaggaggacgtttcctatcttgcctttattcaggagcagagctggtggcttgaggactat
gcgctttttatggcgataaagcagcataacgaactgcgttcgtggatgacatgggacaag
gagttgcgcttcagaaagcccgaagtgcttgccgcattcaaggaagagcatatagaggac
atcaaatttcaccgtttcgtacagtatatgttctttacccagtggaacaagctgaaagca
tatgccaacaagaacggcatatccataataggcgacattccgatatatgccgcaatggac
agtgcggacgtgtgggtaaacccgaaattgttcacgatagatatttcgctaagacctact
cttgttgcaggagtaccgcccgattatttctcacccacaggacagctgtggggaaatccg
ctgtatgactgggacgctatggagcgtgacggctataactggtggctgtcaagaatagac
cacgcaatgaagctgtatgatatggtgagaatagaccacttccgtgcgtttgacacttat
tatgctattcctgccgatgcaacaacagccgaatacggcgagtggaaaaaaggccccggt
atgaagctgttcgatacggtcagggaaaagctgggcgatgtcaatatcatagcggaggat
ctgggcgatatattcgacagcgtaaaaaagcttctcagcgatacgggcttccccggtatg
agagttttacagttcggcttcaacagcgaaggcaaggacagtattcacctgtgccataac
tatgtaaataactgcgtagcgtatacaggcacacacgataacgatactataatgggctgg
cttaaatcagcagatgcgaaagccgcaaagatggcaaagagctacataaacgcaaatttt
ctggagcataagaacgtcagcttcataagaagcgtttatgcaagccctgccgcacttgcg
ataattccgatgcaggacattctcggcatagacggcagaggacgtatgaacgttccctcg
actgtcggaggaaactggacgtggagaatgaaaaagcccgcaaataaaaaatccgcacgt
cttatgaataagctcgcaacagcttatctcagaaagccgtcggtaacagcaaatgcaaag
gacaaataa

DBGET integrated database retrieval system