KEGG   Eubacterium siraeum 70/3: EUS_24510Help
Entry
EUS_24510         CDS       T02590                                 

Definition
acetaldehyde dehydrogenase/alcohol dehydrogenase AdhE (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
esu  Eubacterium siraeum 70/3
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:esu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    EUS_24510
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EUS_24510
   00620 Pyruvate metabolism
    EUS_24510
   00650 Butanoate metabolism
    EUS_24510
  Lipid metabolism
   00071 Fatty acid degradation
    EUS_24510
  Amino acid metabolism
   00350 Tyrosine metabolism
    EUS_24510
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EUS_24510
   00626 Naphthalene degradation
    EUS_24510
Enzymes [BR:esu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EUS_24510
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     EUS_24510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2548674..2551331)
Genome map
AA seq 885 aa AA seqDB search
MAKKQIVSNKTAESAPVSPLIVDNVDALKARMAEVRAAQQEFATFTQEQVDKIFQAAAIA
ANQMRIPLAKMAVEETGMGVVEDKVIKNNYAAEYIYNAYKNTKTCDIIEEDKAFGTMKVA
EPIGVVAAVIPTTNPTSTAIFKTLICLKTRNGIIISPHPRAKKSTIAAAKVVLDAAVAAG
APKGIIAWIDVPSLDLTNEVMRSADIILATGGPGMVKAAYSSGKPALGVGAGNTPAIIDT
TADIKLAVASIVHSKTFDNGMICASEQSVIVLDKIYDKVKKEFASLGCYFLNPEETEKVR
KTILINGALNAKIVGQKAATIAELAGVKVDPKTKVLIGEVESVDIEEEFAHEKLSPVLAM
YKAKDFEEAVAKAERLVADGGYGHTSSLYCNAVTEREKINEFANRMKTCRILVNTPSSHG
GIGDLYNFKLLPSLTLGCGSWGGNSVSENVGVKHLINIKTVAERRENMLWLRLPEKVYFK
KGSMPVALDELGTIMHKKKAFIVTDSFLYHNGNTKAITDKLDQMGISHTVFFNVAPDPTL
ACAKEGAELMKQFQPDVIIALGGGSAMDAGKIMWVLYEHPDVDFLDMAMRYMDIRKRVYT
FPKMGEKAYFVAIPTSSGTGSECTPFAVITDEKTGVKYPLADYQLLPNMAIIDTDNMMTQ
PKGLTSASGVDALTHCLEAYASIMATDYTDGLALKAARNIFEYLPRAYAEGQTDVEAREK
MANASAMAGIAFANAFLGVCHSMAHKLGAFHHLPHGIANALLITHVMRFNAVPNPTKMGT
FSQYDHPHTLERYVEVAEFCGVTGKNNEEKFEKFIAKIEQLKETVGIKKTIKDYGIDEKD
FLDRLDAMTEQAFDDQCTGANPRYPLMSEIKQMYLNAYYGVDETV
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaagcaaatcgtaagcaacaagacagctgaatctgctcccgtaagcccgctg
atcgttgacaatgttgacgctctcaaggctcgtatggcagaagtaagagctgcacagcag
gaattcgcaacctttacacaggagcaggttgataagatcttccaggcagcagcaatcgcc
gctaaccagatgagaatcccgctcgctaagatggcagtagaagaaacaggtatgggtgtt
gttgaagataaggttatcaagaacaactacgcagccgagtacatctacaacgcttacaag
aacacaaagacctgcgacattatcgaagaagacaaggctttcggtacaatgaaggttgca
gagcctatcggtgttgttgccgcagttattcctacaacaaaccccacatcaacagctata
ttcaagacacttatctgtcttaagacaagaaacggtatcataatcagcccccaccccaga
gctaagaagagcacaatcgctgccgctaaggtagttctggacgctgcagttgctgcaggc
gcacctaagggcatcatcgcatggatcgacgttccttcgctcgacctcacaaacgaagtt
atgagaagcgctgatataatcctcgctacaggcggtcccggaatggttaaggctgcttac
tcatcaggcaagcccgctctcggcgttggtgcaggtaacacacccgcaatcattgatact
acagcagacatcaagctcgctgttgcttcaatcgttcactcaaagacatttgataacggt
atgatctgtgcttctgagcagtcagtaatcgtactcgacaagatatatgacaaggttaag
aaggaatttgcatcactcggctgctacttcttaaatcccgaagaaacagaaaaggtaaga
aagacaatccttatcaacggcgcactcaacgcaaagatagttggtcagaaggccgctaca
atcgctgagcttgcaggcgttaaggttgaccccaagactaaggttcttatcggtgaagtt
gaaagcgtagacatcgaagaagagtttgcacacgaaaagctctctcccgtactcgctatg
tacaaggctaaggacttcgaagaagcagttgcaaaggctgaaaggctcgttgctgacggc
ggttacggtcatacatcatctctgtactgcaacgctgttacagagcgtgagaagatcaac
gaattcgccaacagaatgaagacctgccgtatcctcgttaacacaccttcttcacacggc
ggtatcggtgacctttacaacttcaagctcctcccctcattaacactgggttgcggttca
tggggcggtaactccgtatccgaaaacgttggtgttaagcacctcatcaacatcaagaca
gtcgctgagaggagagagaatatgctgtggctgagacttcctgagaaggtttacttcaag
aagggttctatgcctgttgctcttgatgagctgggcacaataatgcacaagaagaaggca
ttcatcgtaacagactccttcttatatcataacggcaacacaaaggctatcacagataag
ctcgatcagatgggtatttctcatacagtattcttcaacgttgctcccgatcctacgctt
gcttgcgctaaggaaggcgcagagctgatgaagcagttccagcccgatgttatcatcgca
ctcggcggcggttctgctatggacgcaggtaagatcatgtgggtactttacgagcatccc
gatgttgacttcctcgatatggctatgagatatatggatatccgtaagagagtttacaca
ttccccaagatgggcgaaaaggcttacttcgtagctatccccacatcttcaggtacaggt
tctgagtgtactcctttcgcagttatcactgacgaaaagacaggcgttaagtatcctctt
gctgactatcagttactgcccaacatggcaatcattgatacagacaacatgatgacacag
cctaagggtctgacaagtgcttcaggtgttgacgcactcacacactgcctcgaggcttac
gcatcaatcatggctacagactacacagacggtcttgctctcaaggctgcaagaaacatc
ttcgagtatctgcccagagcttacgctgaaggtcagacagatgttgaagcaagagagaag
atggctaatgcttctgctatggcaggtatcgcattcgctaacgcattcctcggtgtctgc
cactcaatggctcacaagctcggtgctttccaccacctgcctcacggtattgcaaacgct
ctgcttatcacacacgttatgcgtttcaatgcagttcccaaccccacaaagatgggtaca
ttctcacagtatgatcacccccatactcttgagagatacgttgaagttgctgaattctgc
ggcgtaacaggcaagaacaacgaagagaagttcgagaagttcatcgctaagatcgaacag
ctcaaggaaactgtaggcatcaagaagacaattaaggactacggtattgatgagaaggac
ttcttagacagacttgacgctatgacagagcaggcattcgacgaccagtgcacaggcgct
aaccccagatacccgctgatgagcgagatcaagcagatgtacctcaatgcttactacggc
gttgacgaaacagtttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system