KEGG   Erwinia tasmaniensis: ETA_00980Help
Entry
ETA_00980         CDS       T00711                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
eta  Erwinia tasmaniensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ETA_00980 (pfkA)
   01230 Biosynthesis of amino acids
    ETA_00980 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETA_00980 (pfkA)
   00030 Pentose phosphate pathway
    ETA_00980 (pfkA)
   00051 Fructose and mannose metabolism
    ETA_00980 (pfkA)
   00052 Galactose metabolism
    ETA_00980 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    ETA_00980 (pfkA)
Enzymes [BR:eta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ETA_00980 (pfkA)
Protein phosphatases and associated proteins [BR:eta01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ETA_00980 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
113871..114833
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALSEGLEVCGIYDGYLGLYEDRMINLDRYSVSD
MINRGGTFLGSARFPEFRNEDVRSVAIENMKKRGIDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFIVLPEIPYTREELVNEIKAGIAKGKKHAIVAITEHICDINELAKYIEQETK
RETRATVLGHIQRGGAPVAYDRILASRMGAYSIELLLQGYGGRCVGIQNEKMVHHDIIDA
IENMKRPFKGDWLDTAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaaatcggtgtactgaccagtggtggcgatgctccaggcatgaacgctgcg
atccgcggcgttgtgcgcgccgccctaagcgaaggccttgaagtttgcggtatttatgat
ggctatctgggattgtatgaagaccgcatgatcaatctcgaccgctacagcgtgtcagat
atgatcaatcgcgggggtactttcctgggttccgctcgcttcccggagtttcgaaatgag
gatgtgcgcagcgtcgctatcgaaaacatgaagaaacgcggaattgatgcgctggtggtg
attggcggtgacggttcatatatgggcgctaagcgcctgaccgaaatgggcttcccatgt
atcggtctgccgggcacgatcgataatgacgtagccggcacggattacaccattggctat
ttcaccgcgctggaaaccgtggtggaggcaatagaccgtctgcgtgatacttcttcttcg
caccagcgtatttcaatcgttgaggtgatggggcgttattgtggcgatctgacgctggca
gcggcgattgccggtggctgtgagtttatcgtgctgccggaaattccctatactcgtgaa
gagctggtgaatgagatcaaagccggcatcgccaaaggaaaaaaacacgcgatagtggcg
atcacggaacatatctgtgatatcaacgagctggcgaaatacatcgaacaggaaaccaaa
cgcgaaacgcgcgcaacggtgttgggccatatccagcgcggaggcgctccggttgcctac
gaccgtattctcgcgtcacgtatgggagcctactcgattgagctgctgttacaaggttat
ggcgggcgctgtgtcggtattcagaacgagaagatggtgcatcatgacatcatcgatgcg
attgaaaatatgaagcgtcccttcaaaggtgactggctggataccgccaaaaaactttac
taa

DBGET integrated database retrieval system