KEGG   Erwinia tasmaniensis: ETA_01060Help
Entry
ETA_01060         CDS       T00711                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
eta  Erwinia tasmaniensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ETA_01060 (tpiA)
   01230 Biosynthesis of amino acids
    ETA_01060 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETA_01060 (tpiA)
   00051 Fructose and mannose metabolism
    ETA_01060 (tpiA)
   00562 Inositol phosphate metabolism
    ETA_01060 (tpiA)
Enzymes [BR:eta01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ETA_01060 (tpiA)
Exosome [BR:eta04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ETA_01060 (tpiA)
  Exosomal proteins of bladder cancer cells
   ETA_01060 (tpiA)
  Exosomal proteins of melanoma cells
   ETA_01060 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(123295..124062)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGNKQMVNELIAGLRTELSGVDGCGVAIAPPVMYLEQAKHAISGSPVA
LGAQNVDVNLSGAFTGEVSADMLKDIGAQYIIIGHSERRTWHAESDDAIAKKFAVLKQTG
LIPVLCIGETEAENEAGKTEEVCARQIDAVLNTQGADAFKGVVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKKDATVAAQVIIQYGGSVNDKNAAELFAQPDIDGALVGGASLKAD
AFAAIVKAAAAAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccattagttatgggtaactggaaactgaacggcaacaaacagatggtcaac
gagctgatcgccggtctgcgtaccgagttgagcggcgttgatggctgtggtgtggcgatt
gccccgcccgtcatgtacctggagcaggcgaaacacgccatttccggcagccctgtcgct
ctgggtgcacagaacgttgacgttaatctgtccggcgcgttcaccggtgaagtctctgcc
gacatgctgaaagatatcggcgcgcagtacatcattattggccattccgaacgccgtacc
tggcatgcagaaagcgacgacgctatcgcgaagaaatttgccgtgctgaagcagacgggc
ctgatcccggtgctgtgcatcggtgaaaccgaagcggaaaacgaagcgggtaaaaccgaa
gaagtttgcgcacgccagatcgatgcggtactgaatacccagggcgctgacgctttcaag
ggtgtggttatcgcttacgaacccgtatgggcaatcggcaccggcaaatcagcaaccccg
gctcaggctcaggcggtacacaaattcatccgcgaccacattgccaagaaagatgcgacg
gtagccgcacaggtcatcattcagtacggtggctcagtaaacgataaaaacgcggcagag
ctgtttgcccagcctgatatcgacggcgccctggtgggcggcgcatccctgaaggcagat
gctttcgctgcgatcgttaaagcggcggcagcggcgaaaaaagcctga

DBGET integrated database retrieval system