KEGG   Erwinia tasmaniensis: ETA_01060Help
Entry
ETA_01060         CDS       T00711                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
eta  Erwinia tasmaniensis
Pathway
eta00010  Glycolysis / Gluconeogenesis
eta00051  Fructose and mannose metabolism
eta00562  Inositol phosphate metabolism
eta01100  Metabolic pathways
eta01110  Biosynthesis of secondary metabolites
eta01120  Microbial metabolism in diverse environments
eta01130  Biosynthesis of antibiotics
eta01200  Carbon metabolism
eta01230  Biosynthesis of amino acids
Module
eta_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eta_M00002  Glycolysis, core module involving three-carbon compounds
eta_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETA_01060 (tpiA)
   00051 Fructose and mannose metabolism
    ETA_01060 (tpiA)
   00562 Inositol phosphate metabolism
    ETA_01060 (tpiA)
Enzymes [BR:eta01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ETA_01060 (tpiA)
Exosome [BR:eta04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ETA_01060 (tpiA)
  Exosomal proteins of bladder cancer cells
   ETA_01060 (tpiA)
  Exosomal proteins of melanoma cells
   ETA_01060 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAO95152
UniProt: B2VF53
Position
complement(123295..124062)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGNKQMVNELIAGLRTELSGVDGCGVAIAPPVMYLEQAKHAISGSPVA
LGAQNVDVNLSGAFTGEVSADMLKDIGAQYIIIGHSERRTWHAESDDAIAKKFAVLKQTG
LIPVLCIGETEAENEAGKTEEVCARQIDAVLNTQGADAFKGVVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKKDATVAAQVIIQYGGSVNDKNAAELFAQPDIDGALVGGASLKAD
AFAAIVKAAAAAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccattagttatgggtaactggaaactgaacggcaacaaacagatggtcaac
gagctgatcgccggtctgcgtaccgagttgagcggcgttgatggctgtggtgtggcgatt
gccccgcccgtcatgtacctggagcaggcgaaacacgccatttccggcagccctgtcgct
ctgggtgcacagaacgttgacgttaatctgtccggcgcgttcaccggtgaagtctctgcc
gacatgctgaaagatatcggcgcgcagtacatcattattggccattccgaacgccgtacc
tggcatgcagaaagcgacgacgctatcgcgaagaaatttgccgtgctgaagcagacgggc
ctgatcccggtgctgtgcatcggtgaaaccgaagcggaaaacgaagcgggtaaaaccgaa
gaagtttgcgcacgccagatcgatgcggtactgaatacccagggcgctgacgctttcaag
ggtgtggttatcgcttacgaacccgtatgggcaatcggcaccggcaaatcagcaaccccg
gctcaggctcaggcggtacacaaattcatccgcgaccacattgccaagaaagatgcgacg
gtagccgcacaggtcatcattcagtacggtggctcagtaaacgataaaaacgcggcagag
ctgtttgcccagcctgatatcgacggcgccctggtgggcggcgcatccctgaaggcagat
gctttcgctgcgatcgttaaagcggcggcagcggcgaaaaaagcctga

DBGET integrated database retrieval system