KEGG   Erwinia tasmaniensis: ETA_02110Help
Entry
ETA_02110         CDS       T00711                                 

Gene name
hemD
Definition
uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
eta  Erwinia tasmaniensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:eta00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(254153..254890)
Genome map
AA seq 245 aa AA seqDB search
MSILVTRPAPAADELVSRLRLQGRVAWSFPLIEFTPGTQLDRLPDRLEALEAGDLVFILS
QHVIHYAQPTFNRLESTWPASLNYYAIGRSTALAFHAASGRQVSWPHEQETSEILIQLPD
LQVVTGKRALILRGNGGRELLAETLLNRGAKVEFIECYQRCNKHYHGAEEGRRWRNQGID
TLVVTSGEMLQQLYSLFTDIDRDEWLLHCRLVIVSERLATLARKLGWANIDVADGADNDA
LLRAI
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagcattctggtcactcgccctgcgccggcagcagatgagctggttagccgtctgcgt
cttcaggggagagttgcctggtcgttcccgctgatagaatttaccccaggaacccagctg
gacagactgcccgatcgccttgaggcgctggaggcaggagacctggtttttattctgtcg
caacacgtcatccactatgctcaacccacatttaaccgtttagagtcaacatggcccgcc
agcctgaactattatgcaatagggcgcagtaccgcactggcatttcatgcggccagcggg
cgtcaggtttcgtggccacacgagcaggaaaccagtgaaatactgatccagctgcccgat
ttgcaagtcgtaacgggtaaacgtgcgttgattctgcgcggcaacggggggcgtgaatta
ttggcggaaacactgcttaatcgcggcgctaaagtagaatttattgagtgttatcaacgc
tgcaacaagcactatcacggcgcagaagagggccgacgctggcgcaaccagggcatcgac
acgctggtggtgaccagcggtgaaatgttgcagcagctctactcgcttttcaccgatatc
gatcgtgatgaatggctgttgcactgtcgactggtgatcgtcagtgagcgcctggccact
ctggcgcgaaaactcggatgggcgaacattgatgtcgccgacggtgcggataatgatgca
ctattgcgtgcgatataa

DBGET integrated database retrieval system