KEGG   Erwinia tasmaniensis: ETA_02250Help
Entry
ETA_02250         CDS       T00711                                 

Gene name
pldB
Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
eta  Erwinia tasmaniensis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:eta00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ETA_02250 (pldB)
Enzymes [BR:eta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ETA_02250 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
269872..270864
Genome map
AA seq 330 aa AA seqDB search
MKLRQKSWLTREKAFAAFATGPLLDFWRQREEDEFVGVENVPIRYVRFISPQHDKVILLC
PGRIESYVKYPELAYDLFHSGYDVFIIDHRGQGRSGRLLKDSHRGHVAAFEDYVDDLETL
YLQQIVTRHYRHRYALAHSMGGAILALMLLRQPAAFDAVALAAPMFGIFLPMPLWMARRI
LNWAEKRPLVRDDYALGTGKWRARPFAINDLTHSRERYRRNVRFYADDPGIRVGGPTYHW
VREAVRAGQSVLHQAAQISTPLLLLQAADDKVVDNRAQDLFCQAMVAAGQPCEGDKPLVI
EGARHEILFERDRMRTAALEAVLTFFARHT
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcgccaaaaaagctggttaacgcgtgaaaaagcctttgcggcgtttgccacc
ggcccgctgctggatttctggaggcagcgcgaagaggacgagtttgtcggggtggaaaac
gttccaatccgctacgtccgcttcatctcaccgcaacatgacaaggttattttattgtgt
ccggggcgcattgaaagttatgtcaaatacccggagctggcctacgatctgttccatagc
ggatatgacgttttcattatcgatcatcgcgggcaggggcgatcgggcaggctgctgaag
gattcacatcgtgggcacgttgcggcgttcgaagactacgttgacgatttggaaacgctg
tatttgcaacaaatcgtaacgcgtcactatcggcatcgctacgcgctggcgcattcgatg
gggggagcgatcctcgccctgatgttgctaagacagccggcggcctttgacgcggtggcg
ctggctgcgccgatgtttggcatttttctgccgatgccgttatggatggcgcggcgcatt
ctcaactgggcggaaaaacgcccgttggtgcgcgatgattatgcgttgggcaccggcaaa
tggcgcgcgcgcccctttgcgataaacgatttaacccatagccgcgaacgctatcgccgc
aacgtgcgtttttacgctgacgatcccggcatacgcgtcggcggcccaacgtatcattgg
gtgagagaagccgtgcgcgccgggcaaagcgttttgcatcaggcagcgcagatttccacc
ccgctgctgctgctacaggccgccgacgataaggtggtcgacaaccgtgcacaggatctg
ttttgccaggcgatggtggccgcaggtcagccctgtgagggcgataagccgctggttatc
gagggtgcccgtcacgagatcctgtttgagagagaccggatgcgcacagcggcgctcgaa
gccgtcctcaccttttttgcccggcatacttga

DBGET integrated database retrieval system