KEGG   Erwinia tasmaniensis: ETA_05770Help
Entry
ETA_05770         CDS       T00711                                 

Definition
phage lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
eta  Erwinia tasmaniensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
642996..643505
Genome map
AA seq 169 aa AA seqDB search
MNPSIVKRCLVGAVLAIAATLPGFQSLHTSVEGLKLIADYEGCRLQPYQCSAGAWTDGIG
NTSGVVPGKTITERQAAQGLITNVLRVERQLEKCVVQPMPQKVYDAAVSLAFNVGTGNAC
SSTLVTLLNQQRWADACHQLPRWVYVKGVFNQGLDNRRAREMAWCLKGV
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaatccttcaatcgttaagcgctgccttgtcggggcggtactggctattgccgccacg
ctgcccggttttcagtcgcttcatacctctgttgaggggctgaagctgatcgccgattac
gagggatgccgtctgcagccttatcagtgcagcgcgggtgcgtggactgacgggatcggc
aatacgtccggtgtggtgccgggaaaaaccatcacggaacggcaggcggcgcagggactt
atcaccaacgtgctgcgcgtggaacggcagcttgaaaagtgtgtggtgcagccgatgccg
caaaaagtctatgacgcggcggtgtcgcttgctttcaacgtgggcaccggcaacgcatgc
agctctacgctagttacgttgctgaatcagcagcgctgggctgacgcctgccatcagctg
ccgcgctgggtgtatgtcaaaggtgtgtttaatcaggggctggataaccgccgcgcgcgg
gaaatggcttggtgcttaaaaggagtatag

DBGET integrated database retrieval system