KEGG   Erwinia tasmaniensis: ETA_06070Help
Entry
ETA_06070         CDS       T00711                                 

Gene name
holD
Definition
DNA polymerase III subunit psi (EC:2.7.7.7)
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
eta  Erwinia tasmaniensis
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:eta00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:eta00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:eta03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:eta03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:eta03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
669022..669441
Genome map
AA seq 139 aa AA seqDB search
MSPRRDWLLQQMGITQYTLRRPRALQGEIAVTLPAETRLVIVADNPPMLHDPLVADVLLA
LNLRQPQVQVLTPDQLAMLPDDARCHSWRLGLDAPVTLAGTQIASPVLAELYNNAEAKRA
LWQQICHYESDFFTHSARS
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgtctcccagacgtgactggttactacagcaaatgggcataacgcagtatacgctgcgg
cgtccgcgcgccctgcagggggagatcgcggtcacgctacccgctgaaacccggctggtg
attgtggcggacaatccgcccatgctgcatgatccgctggtggcggacgtcctgctcgca
ctgaatctgcgtcaaccgcaggtgcaggttcttaccccagaccagctggcgatgctgccg
gacgacgcccgctgtcacagctggcgtttaggtctggatgccccggtaacgttagccgga
acccaaattgcttcccccgtactggcggagctttataataatgccgaggccaaacgggcg
ctctggcagcaaatttgccactatgaatcagatttctttactcactccgcacgatcttga

DBGET integrated database retrieval system