KEGG   Erwinia tasmaniensis: ETA_06670Help
Entry
ETA_06670         CDS       T00711                                 

Gene name
deoA
Definition
Thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
eta  Erwinia tasmaniensis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eta00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ETA_06670 (deoA)
Enzymes [BR:eta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     ETA_06670 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
738994..740316
Genome map
AA seq 440 aa AA seqDB search
MFLPQEIIRKKRDGHALSDEEIRSFINGVRDNSVSEGQIAALAMAIWFRDITLPERVALT
MAMRDSGSVLCWKGLDLNGPVVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPSDDRFREIIKQVGIAIVGQTRSLAPADKRFYATRDITATVDSI
PLIAASILGKKLAEGLDALVMDVKVGSGALMPTLEQSEALAQAIFGVANGAGCKTTVLLT
DMNQPLASSAGNALEVREAVQFLTGEYRNPRLLEVTMALCREMLLSGGLAQSDAEAQAKL
QAVLDNGAAAEAFARMVAAQQGPADFIERIDSYLPAPMLSKAVYATTSGIVSTMDTRALG
MAVVALGGGRRRASDSIDYSVGLSHLVQPGDKVDGERPLAVIHAASEASWQQAAQAVQHA
VMVGQQQPASTAVIYRRISQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgttcctgccacaagaaattattcgcaaaaaacgtgacggccatgcgctgagtgatgag
gagatccgctcctttatcaacggcgtgcgtgacaactcggtttccgaggggcagattgcc
gcgctggcgatggccatctggtttcgtgatataactctgccggagcgcgtggcgctgacc
atggcgatgcgtgattccggttcggtactctgctggaaggggcttgaccttaatggcccg
gtggtggacaaacactcaaccggcggcgttggcgatgtcacatcgctgatgcttggcccg
atggtggccgcctgtggcggctatgtgccgatgatctccggtcgtgggctgggtcatacc
ggcggcacgttggataaactggaagccattcccggctttgatattttcccttcggacgac
cgttttcgcgagattatcaaacaggttgggatagcgatcgtcgggcaaacccggtcgctg
gccccggcagataagcgcttttatgccacgcgtgatatcaccgccacggtggattccatt
ccgctgatcgccgcctcgatcctcggcaaaaagctggccgaagggctggatgcgctggtg
atggatgtgaaggtaggttccggggcgctgatgcccactcttgaacaatctgaagcgctg
gcgcaggcgatttttggcgtagcaaacggagccggctgtaaaactaccgtgctgttgacc
gatatgaatcagccgctggcttccagcgcgggtaatgcgctggaagtgcgtgaggcggtg
cagttcctgaccggcgaataccgcaatccgcgcctgctggaagtgacgatggcgctatgc
cgcgaaatgttgctctccggcgggctggcgcagtccgacgctgaagcgcaggcgaagctg
caagccgttctggataacggtgccgccgccgaagcgtttgcccgtatggtggcggcgcag
cagggcccggcggactttatcgagcgtatcgacagctatctgcccgcccccatgctaagt
aaagcggtctatgccacaaccagcggtatcgtcagcacgatggatactcgtgcgctgggg
atggcggtcgtggcgctgggtggggggcgccgccgcgccagtgacagcatcgactacagc
gtggggttgagccatctggtgcagccgggcgataaggttgacggcgaacgaccgctggcg
gtgatccacgccgccagtgaagccagctggcagcaggccgcccaggccgtgcagcatgcc
gtgatggtgggacagcagcagccagcgtcaacggcagttatttatcgcagaatttcacaa
taa

DBGET integrated database retrieval system