KEGG   Erwinia tasmaniensis: ETA_07000Help
Entry
ETA_07000         CDS       T00711                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
eta  Erwinia tasmaniensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:eta00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ETA_07000 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETA_07000 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ETA_07000 (thrC)
Enzymes [BR:eta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ETA_07000 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
779926..781212
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVKQGLGKQQGLFFPLELPEFELTEIDDMLEMDFVTRSSKILS
AFIGDEIPPHQLNERLKTAFTFPAPVVDVTDDIAALELFHGPTLAFKDFGGRFMAQMLSY
VSGADEQITILTATSGDTGAAVAHAFYGMENVRVVILYPQGKISPLQEKLFCTLGGNIET
IAIDGDFDVCQSLVKQAFDDEELKKAIGLNSANSINISRLLAQICYYFEAVAQLPQEKRN
QLVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLADGQWTPNATVATLSN
AMDVSQPNNWPRVEELFRRKTWRLGDLGYGAVNDETTKAAMRELADLGYLSEPHAAIAWR
LLRDGLQDGEFGLFLGTAHPAKFKESVETILERTLPLPDALAERADLPLLSHSMKAEFAE
LRAFLLKK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataatcttaaggatcacaacgagcaggtgagcttcgcccaggcggtgaag
caggggctgggcaaacagcaggggctgttctttcctctggagctacctgagttcgaactg
accgaaattgacgacatgctggaaatggattttgttacccgtagcagcaaaatcctctcg
gcgtttatcggtgatgaaattcctccgcaccagctgaatgagcgtctgaaaacggcgttc
accttcccggctccggtggtggatgtgactgatgatatcgccgcgctggagctgttccac
ggcccgacgctggcgtttaaagatttcggcggtcgctttatggcgcagatgctctcttat
gtgagcggtgcggatgagcagatcactatcctgaccgccacctccggcgataccggtgcc
gccgttgctcatgccttctacggcatggaaaatgtgcgcgtggtgatcctttatccacag
ggcaagatcagtccgctgcaggaaaaactgttctgtaccctcggcggcaacatcgagacc
atcgccatcgacggcgatttcgatgtctgtcagtcgctggtaaaacaggcgtttgacgat
gaggagctgaaaaaggccattggcctgaactcggcgaactcgatcaatatcagccgcctg
ctggcacagatttgctactactttgaggccgtggcgcagctgccgcaggaaaaacgcaat
cagctggtgatttcggtgccgagcggcaactttggcgacctgacggctggcctgctggcg
aagtctcttggcctgccggtgaagcgttttattgccgccaccaacgccaatgacaccgtg
ccgcgcttcctggccgacggccagtggacgccaaatgctaccgtagccacgttgtcaaac
gcgatggacgtcagccagccgaacaactggccgcgcgttgaggagctgttccgccgtaaa
acctggcgtctcggcgatctcggctacggtgcggtcaatgacgaaaccaccaaagcagcc
atgcgcgagctggccgacctcggctacctttctgagccgcatgcggctatcgcctggcgc
ctgctgcgcgatggtttacaggatggtgagtttggcctgttcctcggcaccgcgcacccg
gcgaaatttaaagagagcgtggaaacgatcctggagcgcaccctgccgctgccggatgcg
ctggccgagcgcgccgatctgccgctgctgtctcacagcatgaaagcggagtttgccgag
ctgcgtgcgttcctgctgaagaagtaa

DBGET integrated database retrieval system