KEGG   Erwinia tasmaniensis: ETA_07210Help
Entry
ETA_07210         CDS       T00711                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
eta  Erwinia tasmaniensis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eta00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ETA_07210 (folA)
   00670 One carbon pool by folate
    ETA_07210 (folA)
Enzymes [BR:eta01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     ETA_07210 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
803756..804238
Genome map
AA seq 160 aa AA seqDB search
MMISLIAALAADRVIGMENAMPWHLPADLAWFKKHTLNKPVIMGRRTWESIGRPLPGRLN
IVISRQKGEAEGVVWVTGIEDALSAAGEVEELMVIGGGRIYEQMLPRADRLYLTHIDAEV
EGDTHFPDYEPDEWQSTFSEFHDADENNSHSFCFEILDRR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgatgattagcctgattgctgcccttgcagccgatcgcgtcattggtatggaaaatgcc
atgccgtggcacctgccggccgacctggcctggttcaaaaaacacaccttgaataaaccg
gtgattatgggacgccgtacctgggaatccatcggccgtccgctgccgggccgtctgaat
attgtgatcagtcgccagaagggtgaggccgaaggtgtggtctgggtgaccggcatcgaa
gatgcgctaagtgccgctggtgaggtggaagagctgatggtgatcggcggcggacgtatt
tatgagcaaatgctgccgcgtgccgatcgcctttatctgacgcatattgatgcagaagtg
gagggcgatacccatttcccggactacgaaccggacgaatggcagtcgaccttcagcgag
tttcacgatgctgatgagaacaattcgcacagtttctgttttgagatcctcgatcgccga
taa

DBGET integrated database retrieval system