KEGG   Erwinia tasmaniensis: ETA_07500Help
Entry
ETA_07500         CDS       T00711                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
eta  Erwinia tasmaniensis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:eta00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:eta00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
839030..840517
Genome map
AA seq 495 aa AA seqDB search
MADRKLRDLLAPWVPGAPERALREMTLDSRVAASGDLFVAIKGHAADGRRFIPQAIAQGV
AAVIAEAEGEAEDGQIVETHGVPVIYLAQLSQRLSALAGRFYQQPGEKLKLIGVTGTNGK
TTTTQLLAQWAQLLGETGAVMGTVGNGLYGQLAPAENTTGSAVDVQHLLASLVDKGASLA
AMEISSHGLVQHRVAALPFAAAAFTNLSRDHLDYHGDMARYEAAKWLLFAEHQVGQAIIN
ADDKVGRRWLEKLPDAVAVTMENHLQPGCHGRWLKATKVDYHDGGARVHFSSSWGEGDID
SRLMGAFNVSNLLVALATLLSLDYPLAALTATASQLQPVTGRMEVFSAPGKPTVVVDYAH
TPDALEKALTAARLHCKGRLWCLFGCGGDRDKGKRPLMGAIAEQCADVVVITDDNPRSED
PAAIVSDILSGLLDAGRARVVMGRAQAVTNTVMQAQQGDIVLVAGKGHEDYQIIGHQRFD
YSDRDTVARLLGGFA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatcgtaaactgcgtgatttactggctccgtgggtgccgggcgcaccggagcgc
gcactgcgcgaaatgacgctggacagccgtgtagcggcatcgggcgatctgtttgtcgcg
attaaaggtcatgcggccgacgggcggcgttttattcctcaggcgattgctcagggcgtg
gcggcggtgattgccgaggcggaaggcgaagcggaagacggacagatcgtcgagacgcac
ggcgtcccggtcatttatctggcgcagctttctcaacgtctgtcggcgcttgctggtcgt
ttttaccagcagccgggcgaaaagctaaagctgattggcgtgaccggcaccaatggcaaa
accaccacgacccagcttctggcgcagtgggcgcagctgctgggtgaaaccggcgcggtg
atgggaacggtgggtaacggcctttacgggcagcttgccccggcggaaaacaccaccgga
tcggcggtggatgtgcagcatttgctggcatcgctggtggacaaaggcgcaagcctggcg
gcgatggagatctcttcgcacggcctggtgcagcaccgcgtggcggcgctgccgtttgcg
gcggccgctttcaccaacctcagccgcgatcatctcgactatcacggcgatatggcgcgt
tatgaagccgccaagtggctgctgtttgccgaacatcaggtcggccaggccatcatcaat
gccgatgataaagtcggacgccgctggctggaaaagctgccggatgcggtggcggtgacg
atggaaaatcatctccagccgggctgtcatggccgctggctgaaggcgacaaaggtggat
taccacgacggcggggccagggtgcacttttcctccagctggggagagggggatatcgac
agccgcctgatgggcgcatttaacgtcagtaatctgctggtggcgttggcaacactgctg
tctctggactatccgctggccgcattaacggcgaccgccagccagctgcaacctgttacc
gggcgcatggaggttttcagcgcaccgggcaaaccaacggtggtggtggattatgcccat
actcccgatgcgctggaaaaagcgctgacggcggcacgtctgcactgcaaggggcggctg
tggtgtctgtttggctgcggcggtgaccgcgataaaggcaagcgcccgctgatgggcgcg
attgccgagcagtgtgctgatgtggtggtgatcaccgatgacaatccgcgcagcgaagat
ccggcggctattgttagcgacatattaagcggcctgcttgatgcggggcgcgccagggta
gtcatgggccgtgcgcaagcggtcactaacaccgtgatgcaggcacagcaaggcgatatt
gtgctggttgccggtaaaggccacgaagattaccagattatcggccatcagcgctttgac
tactctgaccgggatacggtcgcgcgtctgctgggggggttcgcttga

DBGET integrated database retrieval system