KEGG   Erwinia tasmaniensis: ETA_11140Help
Entry
ETA_11140         CDS       T00711                                 

Gene name
glk
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
eta  Erwinia tasmaniensis
Pathway
eta00010  Glycolysis / Gluconeogenesis
eta00052  Galactose metabolism
eta00500  Starch and sucrose metabolism
eta00520  Amino sugar and nucleotide sugar metabolism
eta00521  Streptomycin biosynthesis
eta01100  Metabolic pathways
eta01110  Biosynthesis of secondary metabolites
eta01120  Microbial metabolism in diverse environments
eta01130  Biosynthesis of antibiotics
eta01200  Carbon metabolism
Module
eta_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eta_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETA_11140 (glk)
   00052 Galactose metabolism
    ETA_11140 (glk)
   00500 Starch and sucrose metabolism
    ETA_11140 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    ETA_11140 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ETA_11140 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ETA_11140 (glk)
Enzymes [BR:eta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ETA_11140 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PHP_C PaaX_C
Motif
Other DBs
NCBI-ProteinID: CAO96160
UniProt: B2VE30
Position
1243912..1244877
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCEIDNGAISQAKTFSTADYDSLEAVIRAYLAEKQQDIKHGC
IAIACPITDDWVEMTNHDWAFSTSSMKANLAFDSLEIINDFTAVSMAIPMLSEEHLMQFG
GTTPAEDKPVAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAANSEEEDLILEVLREE
LGHVSAERILSGNGLVNLYRAIVKSDHRQPEDLKPRDVTERALQDTCTDCRRALSMFCVI
MGRFGGNLALNLGTFGGVYIAGGIVPRFLEFFKASGFRAAFEDKGRFKDYVAPIPVYLIT
HDYPGLLGSGAHLRQTLGRVL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgactaagtatgctttggtgggagatgtcggcggcactaacgcacgtctggcactgtgt
gaaatagataacggcgccatctcccaggccaaaacgttctccacggcagattatgacagc
ctggaagcggtgatccgcgcttatctggctgaaaaacagcaggatatcaaacatggctgt
attgccattgcctgcccaatcactgacgactgggttgagatgaccaaccacgactgggct
ttttctaccagtagcatgaaggcgaatcttgcttttgactcgctggagatcattaacgat
tttaccgccgtttcaatggctattccgatgctgtcagaggaacatctgatgcagttcggc
ggcaccacgccggctgaagataagcccgttgccgtttacggcgccggaaccggcctcggc
gttgcgcacctggtgcatgttgataaacgctgggtcagtctgccgggcgaaggggggcat
gtcgattttgccgccaatagcgaggaggaagatctgatccttgaggtgctgcgcgaagag
ctggggcacgtttccgccgaacgtattctctccggcaatgggttggttaacctctaccgc
gcgatcgttaagtcagaccaccgccagcctgaagatctgaagccgcgcgatgtcaccgag
cgcgcgttgcaggatacctgtaccgactgccgccgggcgttgtcgatgttctgtgtcatt
atggggcgttttggtggcaatctggcgctgaacctcggcacttttggcggcgtgtatatt
gccggtggcatcgtgccgcgcttccttgaattctttaaagcctctggattccgcgcggcg
tttgaagacaaaggccgctttaaagattatgtcgcgccgatcccggtttaccttattacc
cacgattatccggggctgctggggtctggcgcccatctgcgtcagacgctgggccgcgtg
ctgtaa

DBGET integrated database retrieval system