KEGG   Erwinia tasmaniensis: ETA_11140Help
Entry
ETA_11140         CDS       T00711                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
eta  Erwinia tasmaniensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ETA_11140 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETA_11140 (glk)
   00052 Galactose metabolism
    ETA_11140 (glk)
   00500 Starch and sucrose metabolism
    ETA_11140 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    ETA_11140 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ETA_11140 (glk)
   00524 Butirosin and neomycin biosynthesis
    ETA_11140 (glk)
Enzymes [BR:eta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ETA_11140 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1243912..1244877
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCEIDNGAISQAKTFSTADYDSLEAVIRAYLAEKQQDIKHGC
IAIACPITDDWVEMTNHDWAFSTSSMKANLAFDSLEIINDFTAVSMAIPMLSEEHLMQFG
GTTPAEDKPVAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAANSEEEDLILEVLREE
LGHVSAERILSGNGLVNLYRAIVKSDHRQPEDLKPRDVTERALQDTCTDCRRALSMFCVI
MGRFGGNLALNLGTFGGVYIAGGIVPRFLEFFKASGFRAAFEDKGRFKDYVAPIPVYLIT
HDYPGLLGSGAHLRQTLGRVL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgactaagtatgctttggtgggagatgtcggcggcactaacgcacgtctggcactgtgt
gaaatagataacggcgccatctcccaggccaaaacgttctccacggcagattatgacagc
ctggaagcggtgatccgcgcttatctggctgaaaaacagcaggatatcaaacatggctgt
attgccattgcctgcccaatcactgacgactgggttgagatgaccaaccacgactgggct
ttttctaccagtagcatgaaggcgaatcttgcttttgactcgctggagatcattaacgat
tttaccgccgtttcaatggctattccgatgctgtcagaggaacatctgatgcagttcggc
ggcaccacgccggctgaagataagcccgttgccgtttacggcgccggaaccggcctcggc
gttgcgcacctggtgcatgttgataaacgctgggtcagtctgccgggcgaaggggggcat
gtcgattttgccgccaatagcgaggaggaagatctgatccttgaggtgctgcgcgaagag
ctggggcacgtttccgccgaacgtattctctccggcaatgggttggttaacctctaccgc
gcgatcgttaagtcagaccaccgccagcctgaagatctgaagccgcgcgatgtcaccgag
cgcgcgttgcaggatacctgtaccgactgccgccgggcgttgtcgatgttctgtgtcatt
atggggcgttttggtggcaatctggcgctgaacctcggcacttttggcggcgtgtatatt
gccggtggcatcgtgccgcgcttccttgaattctttaaagcctctggattccgcgcggcg
tttgaagacaaaggccgctttaaagattatgtcgcgccgatcccggtttaccttattacc
cacgattatccggggctgctggggtctggcgcccatctgcgtcagacgctgggccgcgtg
ctgtaa

DBGET integrated database retrieval system