KEGG   Erwinia tasmaniensis: ETA_13330Help
Entry
ETA_13330         CDS       T00711                                 

Gene name
galF
Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalF (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eta  Erwinia tasmaniensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eta00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ETA_13330 (galF)
   00052 Galactose metabolism
    ETA_13330 (galF)
   00500 Starch and sucrose metabolism
    ETA_13330 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    ETA_13330 (galF)
Enzymes [BR:eta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ETA_13330 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1508345..1509241
Genome map
AA seq 298 aa AA seqDB search
MTKLKAVIPVAGLGMHMLPATKAIPKEMLPVVDKPMIQYIIDECVAAGIKEIVLVTHASK
NAVENHFDTSYELEALLEARVKRSLLSEVKSICPPGVTIMNVRQPQPQGLANALLCARPM
LHDEAFVVVLPDVLLDNASADPLRYNLAAMVARFEETGRSQVLAHHMPDADLSEYSVITT
EEALDFPGKVSPILDFVEKPDSPQLLNSNLAAVGRYVLSADIWPELEKLEPGAWGRYQLT
DAIANLNKKTPVDAHLLSGDSFDCGRKLGYMKAFVTWGLRNHTQGRGFREEIQKILAK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcttaaagcagttatccccgttgcggggctcggaatgcacatgcttcctgca
acaaaagctattcctaaagagatgctgcccgtagtcgataagcctatgatccagtacatc
atcgacgagtgcgtagcggcgggtataaaggaaattgtcctggtcacccatgcgtccaag
aatgcggttgaaaaccattttgatacttcttacgaacttgaagccctgcttgaggctcgc
gttaaacgctcactgttgagtgaagtcaaatctatctgcccgccgggagtgacgattatg
aatgtgcgccagccgcagccgcagggattggctaatgctctgctgtgcgcccgcccgatg
ctgcacgatgaagcgtttgtggtggtactaccggacgtgctgctggataatgccagcgcc
gatcccctgcgttacaacctggcggcaatggtggctcgtttcgaagaaaccgggcggagc
caggtgttagctcatcatatgccggacgccgatctgtcagagtattcggtgattaccact
gaagaagcgctggattttccgggtaaagtcagccctattttagacttcgttgagaaacca
gatagcccgcagttgttaaattccaatctcgccgcggtagggcgctatgtgctttctgcc
gatatttggccggagttggaaaaacttgagccaggcgcgtggggccgttatcagctaacg
gacgccattgccaatttgaataagaaaacgcccgtggatgcccatttgctcagcggcgac
agctttgactgcggtcgcaaactgggatatatgaaagcattcgtcacttgggggctgcgt
aaccacacccagggacgtgggtttcgtgaagagatccaaaaaattctggcaaagtga

DBGET integrated database retrieval system