KEGG   Erwinia tasmaniensis: ETA_14280Help
Entry
ETA_14280         CDS       T00711                                 

Gene name
dcyD
Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
eta  Erwinia tasmaniensis
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:eta00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1618310..1619302
Genome map
AA seq 330 aa AA seqDB search
MEASLSLHNIVNFPRLELLGSPTPLEHLPRLSDYLGRDIFIKRDDVTPVAFGGNKLRKLE
FLAADALRAGADVLLTAGAIQSNHVRQTAAVAAKLGLKCVALLENPIDAKSENYLTNGNR
LLLDLMSTEVIMVPELHDPVAQLEQQATLLEAQGFRPYTIPVGGSDALGALGYVECAQEI
AHQSEGVVDFAAVVVASGSAGTHAGLAVGLEQLLPECELVGVTVSRRSAEQRVKVEAIRG
PLSQSLSLESRAPITLWDDYYAPGYGHPNEEGLEAIKLLARLEGIFLDPVYTGKAMAGLI
DGIAQNRFRHQGPLLFVHTGGAPALFAYHP
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggaggccagcttgtctttacacaacattgttaactttccccgccttgaactgttgggt
tcgcccacgcccctagagcatcttcctcgcctgtctgattatttgggtcgcgatattttt
atcaaacgtgacgacgtcacgccggtggcattcggcggcaacaagctgcgcaagctggag
tttctggccgccgacgccctgcgcgccggagccgacgtgctgctgaccgccggggctatc
cagtctaaccatgtgcgccagacggcggcggtggcggcgaagctgggtttaaaatgcgtg
gcgctgctggaaaatcccatcgatgcgaagagcgaaaattacctgactaacggtaatcgt
cttctgctggatttgatgagtacggaagtgattatggtgcctgagctgcacgatccggtg
gcacagttagagcagcaggcgaccctgctggaagcacagggatttcggccttacaccatt
cctgtcggcggttctgacgcgctgggcgcgttgggctacgtcgaatgcgcccaggagatt
gctcaccagagcgaaggcgtggttgattttgccgccgtggtggtcgcttcgggaagtgcg
ggcacgcatgccgggctggcggtcggtctggagcagctgctgccagaatgtgagctggtc
ggcgtcaccgtctcccggcggtcggctgagcagcgggtaaaagtggaggcgatccgtggt
ccgctgtcacaatccctgtcgttggagagccgcgcgccgatcaccctgtgggatgactat
tatgctccgggttacggtcatccgaacgaagaagggttggaggcgataaaactgctggct
cgtctggagggaatattcctcgatccggtctacaccggcaaggcgatggccgggctaatt
gacggcattgcacaaaatcgatttcgtcatcaggggccgctgctgtttgtccataccggc
ggtgccccggcgctgtttgcttatcatccctga

DBGET integrated database retrieval system