KEGG   Erwinia tasmaniensis: ETA_14380Help
Entry
ETA_14380         CDS       T00711                                 

Gene name
phoA
Definition
(GenBank) Alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
eta  Erwinia tasmaniensis
Pathway
eta00730  Thiamine metabolism
eta00790  Folate biosynthesis
eta01100  Metabolic pathways
eta02020  Two-component system
Module
eta_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eta00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    ETA_14380 (phoA)
   00790 Folate biosynthesis
    ETA_14380 (phoA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ETA_14380 (phoA)
Enzymes [BR:eta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ETA_14380 (phoA)
Exosome [BR:eta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ETA_14380 (phoA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:eta00537]
 Enzymes
  ETA_14380 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase
Motif
Other DBs
NCBI-ProteinID: CAO96484
UniProt: B2VJE2
Position
1634913..1636316
Genome map
AA seq 467 aa AA seqDB search
MKQKVFALSIMTSLICSSAVADIATWHRAAQGDITQPGGARRLDSDQTAAIKAALSNSRA
KNVILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALDKKTHKPEYVTDS
AASATAWATGVKSYNGAIGVDVTGKDHPTLLELAKAAGRATGNVSTAELEDATPAAQIAH
VTSRKCYGPVKTSELCPGNALEKGGKGSIAEQLLNARADVTFGGGGKTFAETARGGEWQG
KTLEEQAKLRGYQLVSDLDGMNSLTNANNEKPVLGLFADGNMPVRWKGPKASYHGNLEGK
PVTCEVNAERPASTPTLAQMTDKAITLLSSHTQGFFLQVEGASIDKQDHAANPCGQIGET
VDLDEAVQKALEFARKDGNTLVIVTADHAHSSQIISNDSKAPGLTQTLITKDGSPMTISY
GNSEEESQGHTGTQLRIAAYGPHAANVVGLTDQTDLFYTIKAALGIE
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaaagtctttgctctttcaataatgacgtcattgatctgttcttcggccgtg
gccgatatcgccacctggcaccgcgccgcacagggtgatattacccagccgggcggcgct
cgtcgtcttgacagcgatcagaccgcagcgattaaggccgcgctgagcaatagcagagca
aaaaatgtcattttgttgattggtgatggcatgggtgattcggagatcaccgccgcgcgt
aactatgctgaaggggccggcggcttctttaaaggtatcgacgcgctgccgctcacgggg
cagtacacccattatgcgctggataagaaaacccacaaacctgagtacgtgacggattcc
gcagcatcggcgaccgcctgggcgaccggagtgaaatcctacaatggggccattggggtc
gatgtcactggcaaggatcatccaacgctgcttgagctggcgaaggcagcaggcagggca
accggcaatgtgtctaccgccgagctggaagacgccacgccagcggcgcagattgcacat
gtgacctcacgtaaatgctatggcccggtgaaaaccagcgagttgtgtccaggcaatgcg
ctggagaaaggcgggaagggctcgatagccgagcagctgttgaatgcgcgggcagacgtt
acttttggcggcggtggaaaaaccttcgcggagacggcgcgcggcggagaatggcagggt
aagaccctggaagaacaggcgaagctgcgcggctatcagctggtcagcgaccttgacggg
atgaattctttaactaacgccaataatgaaaagccggtgcttgggctgtttgccgacggc
aatatgccggtgcgttggaaagggccgaaggccagttatcacggtaatctcgagggtaag
ccggtcacctgtgaagttaacgccgaacgcccggcgtctacgccgactctcgcacagatg
accgataaagccattacgctattgagcagccatacgcagggcttcttcctgcaggttgag
ggagcctcaattgataagcaggatcatgcggcaaatccgtgtgggcagatcggcgaaacg
gtcgatttggatgaggcggtgcagaaggcgctggagtttgcccgtaaggacggtaatacc
ctggtgatcgtcaccgccgaccatgcccactccagccagattatttctaacgacagcaag
gctcctggcctgacgcaaacgctgatcaccaaagatggcagccctatgaccatcagctat
ggtaattcggaagaagaatcacagggacataccggcacgcagctaagaattgctgcctat
ggcccacacgcggcgaatgtcgtggggctgactgatcagacggatctgttctataccatt
aaagcggcgctggggatcgagtaa

DBGET integrated database retrieval system