KEGG   Erwinia tasmaniensis: ETA_15630Help
Entry
ETA_15630         CDS       T00711                                 

Gene name
pncA
Definition
nicotinamidase/pyrazinamidase (EC:3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
eta  Erwinia tasmaniensis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:eta00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1773580..1774200)
Genome map
AA seq 206 aa AA seqDB search
MTMRGRQALLLIDLQNDFCSGGALAVREGEQTIAVANRLAAEFQQRGETVIATLDWHPAG
HGSFASSAGTTPGTLGQLHGLPQIWWPDHCVQHSDGAQLHPALDRAAIDLLVHKGENAEI
DSYSAFYDNGHRQQTVLDGWLKEHGVTALTIMGLATDYCVKFSVLDALALGYQVTVVAEG
CRGVNLHPDDSRNALTDMVQAGASLM
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgcgtggacgccaggcgctgttgttaatcgacctgcaaaatgacttttgttcc
ggcggtgcgctggcggtgcgtgagggagaacagaccattgccgtagctaaccgccttgcc
gcagagtttcagcagcgcggcgaaacggtgatagccacgctcgactggcaccctgcgggg
cacggcagtttcgcctccagtgccggaacaacgccgggcacccttggccaactgcacggt
ttgccgcagatatggtggccggaccactgcgtacaacacagcgacggcgcgcagctgcac
ccggcactggatcgtgcggcgatcgacctgctggtacacaaaggtgagaatgcggaaatc
gatagctacagtgcgttttatgataatggccatcgccaacaaaccgtgctggacggctgg
ctgaaggagcacggcgtgacggcactcacgataatgggtctggctaccgactactgcgtt
aaatttagcgtgctggacgccctggcgctgggttatcaggtcaccgtggtggccgagggc
tgtcgcggggtcaatctgcacccagacgacagtcggaacgccctaacagacatggttcag
gcaggtgccagcctgatgtaa

DBGET integrated database retrieval system