KEGG   Erwinia tasmaniensis: ETA_15760Help
Entry
ETA_15760         CDS       T00711                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalU (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eta  Erwinia tasmaniensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eta00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ETA_15760 (galU)
   00052 Galactose metabolism
    ETA_15760 (galU)
   00500 Starch and sucrose metabolism
    ETA_15760 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    ETA_15760 (galU)
Enzymes [BR:eta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ETA_15760 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1787572..1788480
Genome map
AA seq 302 aa AA seqDB search
MSAYNSKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEIQSICPPHVTIMQVRQGLAKGLGHAVM
CAWPVIGNEPVAVILPDVILDEYESDLSKDNLAEMIKRFDETGHSQIMVEPVADVTAYGV
VDCQGAQLNPGESAPMVGVVEKPKADQAPSNLAVVGRYVLSADIWPLLAKTPPGAGDEIQ
LTDSIAMLMEKETVEAYHLKGISHDCGNKLGYMQAFVEYGVRHETLGSDFRAWLESAVGN
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctataactcaaaagtaaaaaaagcggttatccctgttgctggtttaggaacg
cgtatgttgcctgcaacaaaagcgattcctaaagaaatgttaccgttggttgataagccg
ttaattcagtatgtcgttaacgaatgtattgccgcgggcattaatgaaattgtgctggtt
acgcactcctctaaaaactcaattgaaaaccatttcgataccagctttgagctcgaagcc
atgctggaaaaacgcgttaagcgccagctgctggaagagatccagtctatttgtcctcca
cacgtgaccattatgcaggttcgtcaggggttggcaaaaggtctgggccacgcggtcatg
tgtgcatggcctgtcattggtaacgagccggttgccgtgattttgccggacgtgatcctt
gatgaatatgaatccgatctgtcaaaagacaatctggcagagatgatcaaacgctttgat
gaaactggccacagtcagattatggttgaaccggttgcagacgtgaccgcttacggtgtt
gttgactgccagggcgctcagctgaaccccggtgaaagtgcacccatggtcggcgtagta
gaaaaacccaaagcggatcaagcgccttctaatctggccgtcgtcggccgctacgtgctg
tctgctgatatctggccactgctggcgaaaacccctcccggtgctggcgacgaaattcag
ctgaccgactcgatcgcgatgctgatggaaaaagagactgtggaagcctatcacctgaag
ggcataagccatgattgtggtaacaagctgggctacatgcaggctttcgttgaatatggt
gtgcgtcatgagacgctgggcagcgatttcagagcctggctggaaagcgcagtgggtaat
aaaaagtaa

DBGET integrated database retrieval system