KEGG   Erwinia tasmaniensis: ETA_15810Help
Entry
ETA_15810         CDS       T00711                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
eta  Erwinia tasmaniensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eta00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ETA_15810 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETA_15810 (adhE)
   00620 Pyruvate metabolism
    ETA_15810 (adhE)
   00650 Butanoate metabolism
    ETA_15810 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    ETA_15810 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    ETA_15810 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ETA_15810 (adhE)
   00626 Naphthalene degradation
    ETA_15810 (adhE)
Enzymes [BR:eta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ETA_15810 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ETA_15810 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1792866..1795559)
Genome map
AA seq 897 aa AA seqDB search
MTVTNVAELNALVERVKQAQRIYAGFTQEQVDKIFRSAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGILESDDTFGTITIAEPVGLICAIVPTTNPTSTA
IFKALIALKTRNAVIFSPHPRAKDATNQAAKIVLQAAIEAGAPADIIGWIDQPSVELSNQ
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDEYADIKRAVASILMSKTF
DNGVICASEQSVIVVESIYDAVRERFATHGGYVLQGRELQAVQDVILKNGALNAAIVGQP
AAKIAELAGIDVPERTKILIGEVQRTDESEPFAHEKLSPMLAMYRAKDFSDALMKAEKLV
AMGGIGHTSCLYTDQDNQQDRVHAFGSRMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGALPIALEEVADEGAK
RAFIVTDRFLFNQGYADQIIKVLKARGVETEVFSEVAADPTLSIVRQGAEKMHSFKPDVI
IALGGGSPMDAAKIMWVLYEHPETHFADLALRFMDIRKRIYRFPKMGIKAKLVAVTTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGMDAITHALE
AYVSVLANEYSDGQALQALKLLKENLPSSYSQGAKNPLARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHLPHGLANALLIGNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLHLSATSDRTAQKIEKLLAWLESLKTELGIPASIREAGVQEADFLAKLDKLTEDALDDQ
CTGANPRFPLISELKQVLLDSFYGRDFYENRVNPPEAATLRVVAKKGDKNLKGLNQA
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtaacgaatgttgctgaactcaacgcgctggtggaacgtgttaaacaggcacag
cgcatctacgctggcttcacccaagagcaggtcgataagatttttcgctctgcggcactg
gcagcggccgatgcccgtattccgctggccaaaatggcggtggcagaatcaggcatgggt
atcgttgaagataaagtgattaaaaaccatttcgcctctgaatatatctataatgcgtac
aaagatgaaaaaacctgcggcatcctggagagcgatgatactttcggcaccatcaccatc
gccgaacccgttggccttatctgcgctatcgttcccaccactaaccccacctcaacggct
atttttaaagcactgatcgctctgaaaacccgcaacgcggtgatcttttctccgcacccg
cgggcaaaggatgccactaatcaggcggcgaaaattgtgctccaggccgcgattgaagcc
ggggcacctgcggatattattggctggattgaccagccttccgtcgagctgtcaaaccag
ctgatgcaccacccggatattaatctgatccttgccaccggcgggcctggcatggttaag
gcggcgtacagttcaggaaagccggccattggcgttggcgcaggcaacacgccggtggtc
attgatgagtacgcggatatcaagcgcgccgtggcctcaatcctgatgtcgaaaaccttc
gataacggcgtcatctgtgcgtccgagcagtcggtcattgtcgttgaaagcatctatgat
gcggtacgcgaacgttttgccactcacggcggctatgtgttgcagggtagagaactccag
gcggtgcaggacgttatcctgaaaaacggggcgctaaatgccgctattgttggccagccg
gcggcaaaaattgctgaactggccgggattgacgttcctgaaaggactaaaatcctgatc
ggtgaagtgcagcgcaccgatgagtcggagccttttgctcatgaaaaattgtcaccgatg
ctggcaatgtatcgggcaaaagatttttccgacgcgctgatgaaagcggaaaagctggta
gccatgggcggtatcgggcatacctcgtgtctctataccgaccaggataatcagcaggat
cgcgtgcatgccttcggatccaggatgaaaacggcgcgtattctgattaataccccggca
tctcagggtgggatcggcgacctgtataactttaagctcgcgccttcgcttacgcttggc
tgcggttcctgggggggaaactcgatttccgagaatgtcggccccaaacatctgatcaac
aagaaaaccgtcgctaaacgggcagaaaacatgttgtggcataaacttcctaagtcaatc
tacttccgtcgaggcgcattgcccattgctctggaagaggtcgccgatgaaggtgcgaag
cgcgcgtttattgtcaccgatcgttttctgttcaaccagggctatgctgaccagattatt
aaggtgctcaaagcccgtggggtagaaacagaagtattttccgaggtggccgccgatccg
acgctaagcatcgtgcgtcagggcgcagagaagatgcactcgtttaagcccgatgtcatt
atcgctctgggcggtggttcaccgatggatgcggcaaaaatcatgtgggttctatacgaa
catcctgaaacccatttcgctgacctggcattgcgttttatggacatccgcaaacgtatc
taccgcttcccgaaaatgggcattaaggcgaaactggttgccgtcaccaccacctccggc
accggttctgaggttacgccgttcgccgtggttaccgatgatgcgaccggccagaaatat
ccgctggcagactatgctctgacgccggacatggccattgtggatgccaacctggtgatg
gatatgccaaaatctctctgcgcctttgggggaatggacgcgatcacccacgcgctggag
gcctatgtttccgtgctggctaatgaatattcggatggtcaggctctacaggcgctgaaa
ctgctaaaggaaaaccttccgtccagctacagtcagggggcgaaaaacccgctggcgcgt
gaacgtgtgcataatgccgccactattgccggtattgccttcgccaatgcgttcctcggc
gtatgtcactcgatggcgcataaactgggatcggagttccatctgccgcacggcctggcc
aacgcgctgctgataggtaacgtgatccgctataacgccaatgacaaccccaccaagcag
accgcttttagtcagtacgatcgcccgcaggcgcgccgtcgctacgcggaaattgctgac
catctgcatctgagcgcgacatccgaccgcaccgcgcagaaaattgaaaagctgctggca
tggctggaaagcctgaaaaccgagctgggtattccggcatcgattcgcgaggcgggcgta
caggaagccgatttcctggcaaaattagataagcttaccgaagatgctctcgacgaccag
tgcaccggcgcgaatccgcgtttcccattgattagcgagctgaaacaggtgttactggac
agcttctatggccgcgacttttacgaaaaccgggttaatccgccagaggccgcgaccctt
cgcgttgtggcaaaaaaaggggacaaaaatctcaagggattgaatcaggcatga

DBGET integrated database retrieval system